DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG10211 and RBOH F

DIOPT Version :10

Sequence 1:NP_609883.1 Gene:CG10211 / 35106 FlyBaseID:FBgn0032685 Length:1394 Species:Drosophila melanogaster
Sequence 2:NP_564821.1 Gene:RBOH F / 842710 AraportID:AT1G64060 Length:944 Species:Arabidopsis thaliana


Alignment Length:281 Identity:47/281 - (16%)
Similarity:103/281 - (36%) Gaps:74/281 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   324 LTAEKHSSNYSSSVRGGIYNEFATAAMPAFWSMYPPEMLAKKMSAHELLSIAALQKSL------V 382
            ||....::|.|....||:.|    :|:.|        ...:|..|....:.::.|::|      .
plant   135 LTTTSTAANQSGGAGGGLVN----SALEA--------RALRKQRAQLDRTRSSAQRALRGLRFIS 187

  Fly   383 PSQTNAEGWSELALAVHRGRDHGVASYVHALDLCE-------RRFADQSAANVSFDTLAQVSNIP 440
            ..|.|.:||:::.....:...:|   |::..|..:       :.||.:     .||.|::...:.
plant   188 NKQKNVDGWNDVQSNFEKFEKNG---YIYRSDFAQCIGMKDSKEFALE-----LFDALSRRRRLK 244

  Fly   441 EEYITN--LRDIYQNANDIDLLVGALLEEPVVGALFGPTISCLLSLQFEQLKQTDRFWYENEIPP 503
            .|.|.:  |.:.:...||                   .:....|.:.|:.:.:.:         .
plant   245 VEKINHDELYEYWSQIND-------------------ESFDSRLQIFFDIVDKNE---------D 281

  Fly   504 SSFTLDQLKSIRQTTLSGLLCGSHQVSTAQSKAFILEDNYLNSILDCDQLPKFDLKPWQVNP--- 565
            ...|.:::|.|...:.|.......:....:..|.|:|:      ||.::|...:|  ||:..   
plant   282 GRITEEEVKEIIMLSASANKLSRLKEQAEEYAALIMEE------LDPERLGYIEL--WQLETLLL 338

  Fly   566 EDEVHVEHVEVEPATKEAIAE 586
            :.:.::.:.:....|.:|:::
plant   339 QKDTYLNYSQALSYTSQALSQ 359

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG10211NP_609883.1 An_peroxidase 69..537 CDD:460804 36/227 (16%)
An_peroxidase 719..1257 CDD:460804
RBOH FNP_564821.1 NADPH_Ox 169..267 CDD:462469 19/124 (15%)
FRQ1 203..333 CDD:444056 27/173 (16%)
COG4097 453..>768 CDD:443273
FAD_binding_8 624..740 CDD:285293
NAD_binding_6 746..926 CDD:429792
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.