DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and AT1G51210

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_175532.1 Gene:AT1G51210 / 841544 AraportID:AT1G51210 Length:433 Species:Arabidopsis thaliana


Alignment Length:435 Identity:92/435 - (21%)
Similarity:144/435 - (33%) Gaps:120/435 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFPAPSHWLWLEHFQNDLLRQGHHVTSV---NNHPTKHP----HENLTEIIISPSFDIPKHFPKE 89
            |:||..|.|.|....:.|..:|..|:.:   .|.|...|    |.:...::..|       ||..
plant    25 PYPAQGHLLPLLDLTHQLCLRGLTVSIIVTPKNLPYLSPLLSAHPSAVSVVTLP-------FPHH 82

  Fly    90 NIF--SMQFVSDF----NNLELWWTIGLMTTEHAFKDPKVKKLIESKDDHYDLVIIEQFFHEAFL 148
            .:.  .::.|.|.    |.|       :|.:....::|.|..|  |...:..:.:|..|    ||
plant    83 PLIPSGVENVKDLGGYGNPL-------IMASLRQLREPIVNWL--SSHPNPPVALISDF----FL 134

  Fly   149 MFGKRFNCPVVTIGTMG--------YADNIDHAMGILTPW-----------------SLIPHLLL 188
            .:.|....|.....:.|        :..:..|......|.                 ||||...|
plant   135 GWTKDLGIPRFAFFSSGAFLASILHFVSDKPHLFESTEPVCLSDLPRSPVFKTEHLPSLIPQSPL 199

  Fly   189 SH------TDRMTFGQRAYNAYLSLYDAVMRRWVYLPKMQKLAEKYFQGSIEGPLPNV-LDLERN 246
            |.      ...|.|.  :|....:..:.:...::...| ||::|....|  .|||.:| |..|.:
plant   200 SQDLESVKDSTMNFS--SYGCIFNTCECLEEDYMEYVK-QKVSENRVFG--VGPLSSVGLSKEDS 259

  Fly   247 ISLVLINAHRSIDLPRPSMPGLIDVGGAHIQKPKQLPTDLQNFLDNA-TYGVIYFSMGSYVKSTD 310
            :|.|...|                               |.::||.. ...|:|...||....|.
plant   260 VSNVDAKA-------------------------------LLSWLDGCPDDSVLYICFGSQKVLTK 293

  Fly   311 LPQEKTALILKAFGQLKQQVIWKFENDSIGD------LPSNVMIKKWMPQNDILAHPNVKLFITH 369
            ...:..||.|:   :...:.:|..:.|.|.|      ....::::.|.||..:|:|..|..|:.|
plant   294 EQCDDLALGLE---KSMTRFVWVVKKDPIPDGFEDRVAGRGMIVRGWAPQVAMLSHVAVGGFLIH 355

  Fly   370 GGIFGTQEGIYWGVPMLCVPLYGDQ---------HRNTIKSVREG 405
            .|.....|.:..|..:|..|:..||         |.....||.||
plant   356 CGWNSVLEAMASGTMILAWPMEADQFVDARLVVEHMGVAVSVCEG 400

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 92/435 (21%)
UDPGT 37..483 CDD:278624 89/430 (21%)
AT1G51210NP_175532.1 Glycosyltransferase_GTB-type 18..432 CDD:385653 92/435 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.