DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT85A3

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_173655.2 Gene:UGT85A3 / 838845 AraportID:AT1G22380 Length:488 Species:Arabidopsis thaliana


Alignment Length:516 Identity:105/516 - (20%)
Similarity:172/516 - (33%) Gaps:173/516 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFPAPSHWLWLEHFQNDLLR-------QGHHVTSVNNHPTKHPHENL------TEIIISPSF--- 80
            |:||..|       .|.:::       :|.|||.||   |.:.|..|      ..:...|||   
plant    18 PYPAQGH-------INPMMKVAKLLHVKGFHVTFVN---TVYNHNRLLRSRGANALDGLPSFQFE 72

  Fly    81 DIPKHFPKENIFSMQFVSDFNNLELWWTIGLMTTEHAFKDPKVKKLIESKDDHYDLVIIEQFFHE 145
            .||...|:..:.:.|.:.         .:...||::..  ...|||::......|:..:      
plant    73 SIPDGLPETGVDATQDIP---------ALSESTTKNCL--VPFKKLLQRIVTREDVPPV------ 120

  Fly   146 AFLMFGKRFNCPVVTIGTMGYADNIDHAMGILTPWSLIPHLLLSHTDRMTFGQRAYNAYLSLY-- 208
                     :| :|:.|:|.:..::...:|       :|.:....|....|     .|||..|  
plant   121 ---------SC-IVSDGSMSFTLDVAEELG-------VPEIHFWTTSACGF-----MAYLHFYLF 163

  Fly   209 -------------------DAVMRRWVYLPKMQKLAEKYFQGSIEGPLPNVLDLE---------R 245
                               |.|: .|:  |.|..:..|.....|....||.:.|.         :
plant   164 IEKGLCPVKDASCLTKEYLDTVI-DWI--PSMNNVKLKDIPSFIRTTNPNDIMLNFVVREACRTK 225

  Fly   246 NISLVLINA-----HRSIDLPRPSMPGLIDVGGAHIQKPKQLPTDLQ------NFLDNAT----- 294
            ..|.:::|.     |..|...:..:|.:..:|..|:...:::..|.:      |.....|     
plant   226 RASAIILNTFDDLEHDIIQSMQSILPPVYPIGPLHLLVNREIEEDSEIGRMGSNLWKEETECLGW 290

  Fly   295 ------YGVIYFSMGSYVKSTDLPQEKTALILKAFGQLKQQVIWKFENDSIGD----LPSNV--- 346
                  ..|:|.:.||....|.....:.|..|.|.|   ::.:|....||:..    :|...   
plant   291 LNTKSRNSVVYVNFGSITIMTTAQLLEFAWGLAATG---KEFLWVMRPDSVAGEEAVIPKEFLAE 352

  Fly   347 -----MIKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNTIKS----- 401
                 |:..|.||..:|:||.|..|:||.|...|.|.:..||||:|.|.:.:|..|...|     
plant   353 TADRRMLTSWCPQEKVLSHPAVGGFLTHCGWNSTLESLSCGVPMVCWPFFAEQQTNCKFSCDEWE 417

  Fly   402 --------VREGYARSLV-------------------------FSKLTTDDLVRNIETLIN 429
                    |:.|...::|                         .:||.....|.|.||::|
plant   418 VGIEIGGDVKRGEVEAVVRELMDGEKGKKMREKAVEWRRLAEKATKLPCGSSVINFETIVN 478

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 105/516 (20%)
UDPGT 37..483 CDD:278624 102/511 (20%)
UGT85A3NP_173655.2 Glycosyltransferase_GTB_type 9..478 CDD:299143 104/514 (20%)
MGT 20..459 CDD:273616 97/493 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.