DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and AT1G10400

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_172511.3 Gene:AT1G10400 / 837580 AraportID:AT1G10400 Length:467 Species:Arabidopsis thaliana


Alignment Length:215 Identity:51/215 - (23%)
Similarity:84/215 - (39%) Gaps:56/215 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   286 LQNFLDNAT-------------------YGVIYFSMGSYVKSTDLPQEKTALILKAFGQLKQQVI 331
            :.||||:..                   ..|:|.:.||..:.:....|:.||.|:   :.|...:
plant   252 VNNFLDDEVEEKVKPSWMKWLDEKRDKGCNVLYVAFGSQAEISREQLEEIALGLE---ESKVNFL 313

  Fly   332 WKFENDSIGD------LPSNVMIK-KWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVP 389
            |..:.:.||.      ....:|:: :|:.|..||.|.:|:.|::|.|.....|.|...||:|..|
plant   314 WVVKGNEIGKGFEERVGERGMMVRDEWVDQRKILEHESVRGFLSHCGWNSLTESICSEVPILAFP 378

  Fly   390 LYGDQHRNTIKSVR------------EGYARSLVFSKLTTD--------DLVRNIETLINDPQYK 434
            |..:|..|.|..|.            ||..|....::...:        :|.||:|..   .:..
plant   379 LAAEQPLNAILVVEELRVAERVVAASEGVVRREEIAEKVKELMEGEKGKELRRNVEAY---GKMA 440

  Fly   435 RSALE----VSQRFRDNPIH 450
            :.|||    .|::..||.|:
plant   441 KKALEEGIGSSRKNLDNLIN 460

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 51/215 (24%)
UDPGT 37..483 CDD:278624 51/215 (24%)
AT1G10400NP_172511.3 Glycosyltransferase_GTB_type 5..459 CDD:299143 50/212 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.