DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT72E2

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_201470.1 Gene:UGT72E2 / 836802 AraportID:AT5G66690 Length:481 Species:Arabidopsis thaliana


Alignment Length:440 Identity:84/440 - (19%)
Similarity:147/440 - (33%) Gaps:152/440 - (34%)


- Green bases have known domain annotations that are detailed below.


  Fly   112 MTTEHA--FKDPKV----------KKLIESKDDHYDLVIIEQFFHEAFLMFGKRFNCPVVTIGT- 163
            :|..||  |..|.:          |:|..:...|..:.::|.....|...|.......:|.:.: 
plant     3 ITKPHAAMFSSPGMGHVIPVIELGKRLSANNGFHVTVFVLETDAASAQSKFLNSTGVDIVKLPSP 67

  Fly   164 --MGYADNIDHA---MGIL-----------------TPWSLIPHLLLSHTDRMTFGQRAYNAYLS 206
              .|..|..||.   :|::                 .|.:||..|.  .||.:... :.:|....
plant    68 DIYGLVDPDDHVVTKIGVIMRAAVPALRSKIAAMHQKPTALIVDLF--GTDALCLA-KEFNMLSY 129

  Fly   207 LYDAVMRRW----VYLPKMQK-LAEKY----------------FQGSIEGPL----PNVLDLERN 246
            ::.....|:    :|.|.:.| :.|::                |:.:::..|    |...|..|:
plant   130 VFIPTNARFLGVSIYYPNLDKDIKEEHTVQRNPLAIPGCEPVRFEDTLDAYLVPDEPVYRDFVRH 194

  Fly   247 ISLVLINAHRSIDLPRPSMPGLIDVGGAHIQKPKQLPTDLQNFLDNATYGVIYFSMGSYVK---- 307
                        .|..|...|:: |......:||.|.:.|...|......|..:.:|...:    
plant   195 ------------GLAYPKADGIL-VNTWEEMEPKSLKSLLNPKLLGRVARVPVYPIGPLCRPIQS 246

  Fly   308 -STDLP-------QEKTALILKAFG------------------QLKQQVIWKF------------ 334
             .||.|       |...:::..:||                  |.:|:.:|..            
plant   247 SETDHPVLDWLNEQPNESVLYISFGSGGCLSAKQLTELAWGLEQSQQRFVWVVRPPVDGSCCSEY 311

  Fly   335 --------ENDSIGDLPS---------NVMIKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWG 382
                    |:::...||.         ..::..|.||.:||:|..|..|:||.|...|.|.:..|
plant   312 VSANGGGTEDNTPEYLPEGFVSRTSDRGFVVPSWAPQAEILSHRAVGGFLTHCGWSSTLESVVGG 376

  Fly   383 VPMLCVPLYGDQHRNTIKSVREGYARSLVFSKLTTDDLVRNIETLINDPQ 432
            |||:..||:.:|:.|               :.|.:|:|  .|...::||:
plant   377 VPMIAWPLFAEQNMN---------------AALLSDEL--GIAVRLDDPK 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 84/440 (19%)
UDPGT 37..483 CDD:278624 84/440 (19%)
UGT72E2NP_201470.1 PLN02992 1..481 CDD:178572 84/440 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.