DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and AT5G37950

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_198611.1 Gene:AT5G37950 / 833774 AraportID:AT5G37950 Length:351 Species:Arabidopsis thaliana


Alignment Length:354 Identity:73/354 - (20%)
Similarity:129/354 - (36%) Gaps:91/354 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    87 PKENIFSMQFV--------SDFNNL-ELWWTIGL-MTTEHAFKDPKVKKLIESKDDHYDLVIIEQ 141
            |.:::...||:        ||...| .:|:.|.| ...|.:||....:.|::.::: ...||.::
plant    27 PSKDLADFQFITIPESLPASDLKTLGPIWFIIKLNKECEISFKKCLGQFLLQQQEE-IACVIYDE 90

  Fly   142 F--FHEAFLMFGKRFNCPVVTIGTMGYADNIDHAMGILTPWSLIPHLLLSHTDRMTFGQRAYNAY 204
            |  |.||   ..|.||                           :|.::.|..:...|..|:....
plant    91 FMYFAEA---AAKEFN---------------------------LPKVIFSTENATAFACRSAMCK 125

  Fly   205 LSLYDAVM-------RRWVYLPKMQKLAEKYFQGSIEGPLPNVLDLERN------ISLVLINA-- 254
            |...|.:.       |....:|::..|..|....|...|:...:::.::      .|.::||.  
plant   126 LYAKDGIAPLTEGCGREEELVPELHPLRYKDLPTSAFAPVEASVEVFKSSCEKGTASSMIINTVS 190

  Fly   255 ----------HRSIDLPRPSMPGLIDVGGAHIQKPKQLPTDLQNFLD----NATYGVIYFSMGSY 305
                      .:.:.:|...:..|..|..|   .|..|..:.::.:|    .....|||.|:||:
plant   191 CLEISSLEWLQQELKIPIYPIGPLYMVSSA---PPTSLLDENESCIDWLNKQKPSSVIYISLGSF 252

  Fly   306 VKSTDLPQEKTALILKAFGQLKQQVIW----------KFEND---SIGDLPSNVMIKKWMPQNDI 357
               |.|..::...:........|..:|          :..|:   |:.::|....|.||..|..:
plant   253 ---TLLETKEVLEMASGLVSSNQYFLWAIRPGSILGSELSNEELFSMMEIPDRGYIVKWATQKQV 314

  Fly   358 LAHPNVKLFITHGGIFGTQEGIYWGVPML 386
            |||..|..|.:|.|...|.|.|..|:|::
plant   315 LAHAAVGAFWSHCGWNSTLESIGEGIPIV 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 73/354 (21%)
UDPGT 37..483 CDD:278624 73/354 (21%)
AT5G37950NP_198611.1 Glycosyltransferase_GTB_type 1..343 CDD:299143 73/352 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.