DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and AT5G03490

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_195969.1 Gene:AT5G03490 / 831823 AraportID:AT5G03490 Length:465 Species:Arabidopsis thaliana


Alignment Length:441 Identity:92/441 - (20%)
Similarity:158/441 - (35%) Gaps:133/441 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFPAPSHWLWLEHFQNDLLRQGHHVTSV-------------NNHPTKHPHENLTEIIISPSFDIP 83
            ||||..|.|.|....:.|..:|.:|:.:             :.||:     ::|.::    |..|
plant    24 PFPAQGHLLPLLDLTHQLCLRGFNVSVIVTPGNLTYLSPLLSAHPS-----SVTSVV----FPFP 79

  Fly    84 KHFPK-----ENIFSMQFVSDFNNLELWWTIGLMTTEHAFKDPKVKKLIESKDDHYD--LVIIEQ 141
            .| |.     ||:   :.|.:..||.      :|.:....::|    :|.....|.:  :.:|..
plant    80 PH-PSLSPGVENV---KDVGNSGNLP------IMASLRQLREP----IINWFQSHPNPPIALISD 130

  Fly   142 FF----HEAFLMFG----KRFNCPVVTIGTMGYA-DNIDHAMGILTPWSLIPHLLLSHTDRMTFG 197
            ||    |:.....|    ..|:.....:..:.:. :|||               |:..||.:.. 
plant   131 FFLGWTHDLCNQIGIPRFAFFSISFFLVSVLQFCFENID---------------LIKSTDPIHL- 179

  Fly   198 QRAYNAYLSLYDAVMRRWVYLPKMQKLAEKYFQGSIEGPLPNVLDLE--RNISLVLIN------- 253
                   |.|..|.:.:..:||.:       .:.|::.|.|   |||  ::.|:.|::       
plant   180 -------LDLPRAPIFKEEHLPSI-------VRRSLQTPSP---DLESIKDFSMNLLSYGSVFNS 227

  Fly   254 ----------------AHRSIDLPRPSMPGLIDVGGAHIQKPKQLPTDLQNFLDNATYG-VIYFS 301
                            .|..:.:..|    |..:|.........:...|.::||.:..| |:|..
plant   228 SEILEDDYLQYVKQRMGHDRVYVIGP----LCSIGSGLKSNSGSVDPSLLSWLDGSPNGSVLYVC 288

  Fly   302 MGSYVKSTDLPQEKTALILKAFGQLKQQVIWKFENDSIGD------LPSNVMIKKWMPQNDILAH 360
            .||....|....:..||.|:   :...:.:|..:.|.|.|      ....::::.|:.|..:|.|
plant   289 FGSQKALTKDQCDALALGLE---KSMTRFVWVVKKDPIPDGFEDRVSGRGLVVRGWVSQLAVLRH 350

  Fly   361 PNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNTIKSVREGYARSLV 411
            ..|..|::|.|.....|||..|..:|..|:..||..|         ||.||
plant   351 VAVGGFLSHCGWNSVLEGITSGAVILGWPMEADQFVN---------ARLLV 392

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 92/441 (21%)
UDPGT 37..483 CDD:278624 88/436 (20%)
AT5G03490NP_195969.1 Glycosyltransferase_GTB_type 19..460 CDD:299143 92/441 (21%)
YjiC 19..447 CDD:224732 92/441 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.