DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT78D2

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_197207.1 Gene:UGT78D2 / 831568 AraportID:AT5G17050 Length:460 Species:Arabidopsis thaliana


Alignment Length:335 Identity:78/335 - (23%)
Similarity:128/335 - (38%) Gaps:75/335 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   171 DHAMGILTPW---------SLIPHLLLSHTD--RMTFGQRAYNAYLSLYDAVMRRWVYLPKMQKL 224
            |.|..|...|         ||..||   :||  |.|.|.:.....:.....|      :..|:|:
plant   131 DMATEINASWIAFWTAGANSLSAHL---YTDLIRETIGVKEVGERMEETIGV------ISGMEKI 186

  Fly   225 AEKYF-QGSIEGPLPNV---------LDLERNISLVLINAHRSIDLP------RPSMPGLIDVG- 272
            ..|.. :|.:.|.|.:|         |.|.| .:.|.||:...:| |      |......:::| 
plant   187 RVKDTPEGVVFGNLDSVFSKMLHQMGLALPR-ATAVFINSFEDLD-PTLTNNLRSRFKRYLNIGP 249

  Fly   273 ----GAHIQKPKQLPTDLQNFLDNATYG-VIYFSMGSYVKSTDLPQEKTALILKAFGQLKQQVIW 332
                .:.:|:..|.|.....:::..:.| |.|.|.|:.:..   |..:.|.|.:.....|...:|
plant   250 LGLLSSTLQQLVQDPHGCLAWMEKRSSGSVAYISFGTVMTP---PPGELAAIAEGLESSKVPFVW 311

  Fly   333 KFENDSIGDLPSNVM--------IKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVP 389
            ..:..|:..||...:        :..|.||.::|.|....:|:||.|.....|.:..||||:|.|
plant   312 SLKEKSLVQLPKGFLDRTREQGIVVPWAPQVELLKHEATGVFVTHCGWNSVLESVSGGVPMICRP 376

  Fly   390 LYGDQHRN--TIKSVREGYARSLVFSKLTTDDLVRNIETLI----------NDPQYKRSALEV-- 440
            .:|||..|  .::.|.| ...:::....|.|...:.::.::          |..:.|..|.|.  
plant   377 FFGDQRLNGRAVEVVWE-IGMTIINGVFTKDGFEKCLDKVLVQDDGKKMKCNAKKLKELAYEAVS 440

  Fly   441 -----SQRFR 445
                 |:.||
plant   441 SKGRSSENFR 450

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 78/335 (23%)
UDPGT 37..483 CDD:278624 78/335 (23%)
UGT78D2NP_197207.1 GT1_Gtf-like 12..438 CDD:340817 74/321 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.