DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT78D3

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_197205.1 Gene:UGT78D3 / 831566 AraportID:AT5G17030 Length:459 Species:Arabidopsis thaliana


Alignment Length:324 Identity:79/324 - (24%)
Similarity:123/324 - (37%) Gaps:86/324 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly   151 GKRFNCPVVTIGTMGYADNIDHAMGILTPW---------SLIPHLLLSHTDRM-------TFGQR 199
            |::|.| ::|...:..|.. ..|..:...|         ||..||   :||.:       ..|:|
plant   110 GRKFKC-ILTDAFLWLAAE-TAAAEMKASWVAYYGGGATSLTAHL---YTDAIRENVGVKEVGER 169

  Fly   200 AYNAYLSLYDAVMRRWV-YLPKMQKLAEKYFQ-GSIEGPLPNV---------LDLERNISLVLIN 253
                        |...: ::..|:|:..|..| |.:.|.|.:|         |.|.| .:.|.||
plant   170 ------------MEETIGFISGMEKIRVKDTQEGVVFGNLDSVFSKTLHQMGLALPR-ATAVFIN 221

  Fly   254 AHRSIDLP------RPSMPGLIDVGG-AHIQKPKQLPT---DLQNFL----DNATYGVIYFSMGS 304
            :...:| |      |......:::|. |.:..|.|..|   |....|    ..:|..|.|.:.|.
plant   222 SFEELD-PTFTNDFRSEFKRYLNIGPLALLSSPSQTSTLVHDPHGCLAWIEKRSTASVAYIAFGR 285

  Fly   305 YVKSTDLPQEKTALILKAFGQLKQQVIWKFENDSIGDLPSNV--------MIKKWMPQNDILAHP 361
            .  :|..|.|..| |.:.....|...:|..:...:..||...        |:..|.||.::|.|.
plant   286 V--ATPPPVELVA-IAQGLESSKVPFVWSLQEMKMTHLPEGFLDRTREQGMVVPWAPQVELLNHE 347

  Fly   362 NVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRN------------TIKS---VREGYARSL 410
            .:.:|::|||.....|.:..||||:|.|::||...|            ||.|   .::|:..||
plant   348 AMGVFVSHGGWNSVLESVSAGVPMICRPIFGDHAINARSVEAVWEIGVTISSGVFTKDGFEESL 411

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 79/324 (24%)
UDPGT 37..483 CDD:278624 79/324 (24%)
UGT78D3NP_197205.1 Glycosyltransferase_GTB_type 6..458 CDD:299143 79/324 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
44.050

Return to query results.
Submit another query.