DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT76C2

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_196205.1 Gene:UGT76C2 / 830471 AraportID:AT5G05860 Length:450 Species:Arabidopsis thaliana


Alignment Length:445 Identity:99/445 - (22%)
Similarity:153/445 - (34%) Gaps:144/445 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    24 GSRILFMGPFPAPSHWLWLEHFQNDLLR-------QGHHVTSVN---NHPTKHPHENLTEIIISP 78
            |.|::.   ||.|     |:...|.:|:       :|..:|.::   |.|....|...|.:    
plant     7 GLRVIL---FPLP-----LQGCINPMLQLANILHVRGFSITVIHTRFNAPKASSHPLFTFL---- 59

  Fly    79 SFDIPKHFPKENIFS--MQFVSDFNNLELWWTIGLMTTEHAFKDPKVKKLIESKDDHYDLVIIEQ 141
              .||....:..|..  |..::..|          :..|..|:|...|.|:|||:          
plant    60 --QIPDGLSETEIQDGVMSLLAQIN----------LNAESPFRDCLRKVLLESKE---------- 102

  Fly   142 FFHEAFLMFGKRFNCPVVTIGTMGYADNIDHAMGILTPWSLIPHLLLSHTDRMTFGQRAYNAYLS 206
                     .:|..|.:...|.: :..::..::       .:|.|:|     .||....:|||.|
plant   103 ---------SERVTCLIDDCGWL-FTQSVSESL-------KLPRLVL-----CTFKATFFNAYPS 145

  Fly   207 LYDAVMRRWVYLPKMQKLAEKYFQGSIEGPLPNVLDLE-RNISLVLINAHRSIDLPRPSMPGLID 270
            |  .::|...|||..:..|        |..:|....|: |::|.|.......:|   |.:..:::
plant   146 L--PLIRTKGYLPVSESEA--------EDSVPEFPPLQKRDLSKVFGEFGEKLD---PFLHAVVE 197

  Fly   271 V----GGAHIQKPKQLPTD---LQNFL----------------------------------DNAT 294
            .    .|......::|..|   |.|.:                                  |...
plant   198 TTIRSSGLIYMSCEELEKDSLTLSNEIFKVPVFAIGPFHSYFSASSSSLFTQDETCILWLDDQED 262

  Fly   295 YGVIYFSMGSYVKSTDLPQEKTALILKAFG--QLKQQVIWKFENDS--------------IGDLP 343
            ..|||.|:||.|..|:     |..:..|.|  ..||..:|.....|              :..|.
plant   263 KSVIYVSLGSVVNITE-----TEFLEIACGLSNSKQPFLWVVRPGSVLGAKWIEPLSEGLVSSLE 322

  Fly   344 SNVMIKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNT 398
            ....|.||.||.::|||.....|:||.|...|.|.|..||||:|:|...||..|:
plant   323 EKGKIVKWAPQQEVLAHRATGGFLTHNGWNSTLESICEGVPMICLPGGWDQMLNS 377

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 99/445 (22%)
UDPGT 37..483 CDD:278624 94/432 (22%)
UGT76C2NP_196205.1 Glycosyltransferase_GTB_type 1..450 CDD:299143 99/445 (22%)
YjiC 9..429 CDD:224732 98/443 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.