DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and AT4G36770

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_195395.4 Gene:AT4G36770 / 829830 AraportID:AT4G36770 Length:457 Species:Arabidopsis thaliana


Alignment Length:485 Identity:97/485 - (20%)
Similarity:178/485 - (36%) Gaps:153/485 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    49 LLRQGHHVTSVNNHPTKHPHENLTEIIISPSFDIPKHF---------PKENIFSMQFVS-DFNNL 103
            :|..|.|:.   ||   |..:.:|..:::......|..         ||   |.::|:. |.:..
plant    19 ILELGKHLL---NH---HGFDRVTVFLVTDDVSRSKSLIGKTLMEEDPK---FVIRFIPLDVSGQ 74

  Fly   104 ELWWTIGLMTTEHAFKD-PKVKKLIESKDDHYDLVIIEQFFHEAFLMFGKRFNCPVVTIGTMGYA 167
            :|..::.....|...|. |::|..:...:....:.:::....|| |...|.       :|.|.  
plant    75 DLSGSLLTKLAEMMRKALPEIKSSVMELEPRPRVFVVDLLGTEA-LEVAKE-------LGIMR-- 129

  Fly   168 DNIDHAMGILTPWSLIPHLLLSHTDRMTFGQRAYNAYLSLYDAVM---------------RRWV- 216
               .|.:...:.|.|...:.::..|:    |..|. .||...|::               |::: 
plant   130 ---KHVLVTTSAWFLAFTVYMASLDK----QELYK-QLSSIGALLIPGCSPVKFERAQDPRKYIR 186

  Fly   217 YLPKMQKLAEKYFQGSIEGPLPNV------------LDLERNISLVL--INAHRSIDLPRPSMPG 267
            .|.:.|::.::..  :.:|...|.            ||.| |:..|:  :..:....|.||:.||
plant   187 ELAESQRIGDEVI--TADGVFVNTWHSLEQVTIGSFLDPE-NLGRVMRGVPVYPVGPLVRPAEPG 248

  Fly   268 L-------IDVGGAHIQKPKQLPTDLQNFLDNATYGVIYFSMGSYVKSTDLPQEKTALILKAFGQ 325
            |       :|:      :||:              .|:|.|.||....|.....:.|..|:..| 
plant   249 LKHGVLDWLDL------QPKE--------------SVVYVSFGSGGALTFEQTNELAYGLELTG- 292

  Fly   326 LKQQVIW------------------KFENDSIGDLPS---------NVMIKKWMPQNDILAHPNV 363
              .:.:|                  |.|.:.:..||:         .::::.|.||.:||||.:.
plant   293 --HRFVWVVRPPAEDDPSASMFDKTKNETEPLDFLPNGFLDRTKDIGLVVRTWAPQEEILAHKST 355

  Fly   364 KLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNT------IK-----SVREGYARSLVFSKLTT 417
            ..|:||.|.....|.|..||||:..|||.:|..|.      :|     :|.:|..:..|.:::..
plant   356 GGFVTHCGWNSVLESIVNGVPMVAWPLYSEQKMNARMVSGELKIALQINVADGIVKKEVIAEMVK 420

  Fly   418 --------DDLVRNIETLINDPQYKRSALE 439
                    .::.:|::.|      |::|.|
plant   421 RVMDEEEGKEMRKNVKEL------KKTAEE 444

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 97/485 (20%)
UDPGT 37..483 CDD:278624 97/485 (20%)
AT4G36770NP_195395.4 Glycosyltransferase_GTB_type 4..448 CDD:299143 97/485 (20%)
YjiC 6..451 CDD:224732 97/485 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.