DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and AT4G27560

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_194486.1 Gene:AT4G27560 / 828865 AraportID:AT4G27560 Length:455 Species:Arabidopsis thaliana


Alignment Length:117 Identity:31/117 - (26%)
Similarity:50/117 - (42%) Gaps:21/117 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   350 KWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNTIKSVREGYARSLVFSK 414
            :|:.|..:|:||:|..|::|.|.....|.:.....::.||..|||..||               :
plant   323 EWVQQPLLLSHPSVGCFVSHCGFGSMWESLLSDCQIVLVPQLGDQVLNT---------------R 372

  Fly   415 LTTDDLVRNIETLINDPQY--KRSALEV--SQRFRDNPIHPL--DEATFWIE 460
            |.:|:|..::|....:..:  |.|..:.  |...||:.|..|  ...|.|.|
plant   373 LLSDELKVSVEVAREETGWFSKESLFDAINSVMKRDSEIGNLVKKNHTKWRE 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 31/117 (26%)
UDPGT 37..483 CDD:278624 31/117 (26%)
AT4G27560NP_194486.1 PLN02764 1..453 CDD:178364 31/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.