DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT84A3

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_193284.1 Gene:UGT84A3 / 827221 AraportID:AT4G15490 Length:479 Species:Arabidopsis thaliana


Alignment Length:167 Identity:49/167 - (29%)
Similarity:73/167 - (43%) Gaps:31/167 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly   270 DVGGAHIQKPKQLPTDLQNFLDN-ATYGVIYFSMGSYVKSTDLPQEKTALILKAFGQLKQ--QVI 331
            ||.| .|.:|   .:|...:||: ....|:|.|.|:.   .:|.||:...|  |.|.|..  .|:
plant   258 DVKG-DISEP---ASDCMEWLDSREPSSVVYISFGTI---ANLKQEQMEEI--AHGVLSSGLSVL 313

  Fly   332 WKFENDSIG----------DLPSNVMIKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPML 386
            |.......|          :|.....|.:|.||..:||||.:..|::|.|...|.|.:..|||::
plant   314 WVVRPPMEGTFVEPHVLPRELEEKGKIVEWCPQERVLAHPAIACFLSHCGWNSTMEALTAGVPVV 378

  Fly   387 CVPLYGDQHRNTI-------KSVR--EGYARSLVFSK 414
            |.|.:|||..:.:       ..||  .|.|..::.|:
plant   379 CFPQWGDQVTDAVYLADVFKTGVRLGRGAAEEMIVSR 415

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 49/167 (29%)
UDPGT 37..483 CDD:278624 49/167 (29%)
UGT84A3NP_193284.1 PLN02555 1..479 CDD:178170 49/167 (29%)
YjiC 8..450 CDD:224732 49/167 (29%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.