DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT71B5

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001328018.1 Gene:UGT71B5 / 827194 AraportID:AT4G15280 Length:510 Species:Arabidopsis thaliana


Alignment Length:309 Identity:71/309 - (22%)
Similarity:124/309 - (40%) Gaps:84/309 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly   179 PWSLIPHLLLSHTDRMTFGQRAYNAYLSLYDAVMRRWVYLPKMQKLAEKYFQGSIEGPLPN-VLD 242
            |...:||:|.|                       :.|:.|    .||:......::|.|.| |.:
plant   215 PVKCLPHILTS-----------------------KEWLPL----SLAQARCFRKMKGILVNTVAE 252

  Fly   243 LERNISLVLINAHRSIDLPR--PSMPGLIDVGGAHIQK-----PKQLPTDLQNFLD-NATYGVIY 299
            ||.: :|.:.|.:.. |||:  |..|.|      |::.     .||  :::..:|| ..:..|::
plant   253 LEPH-ALKMFNINGD-DLPQVYPVGPVL------HLENGNDDDEKQ--SEILRWLDEQPSKSVVF 307

  Fly   300 FSMGSYVKSTDLPQEKTALILKAFGQLKQQVIW-------KFENDSIGD-------LPSNVM--- 347
            ...||....|:....:||:.|...|   |:.:|       ..:.|...|       ||...:   
plant   308 LCFGSLGGFTEEQTRETAVALDRSG---QRFLWCLRHASPNIKTDRPRDYTNLEEVLPEGFLERT 369

  Fly   348 -----IKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNTIKSVRE--- 404
                 :..|.||..:|..|.:..|:||.|.....|.:::||||:..|||.:|..|..:.|.|   
plant   370 LDRGKVIGWAPQVAVLEKPAIGGFVTHCGWNSILESLWFGVPMVTWPLYAEQKVNAFEMVEELGL 434

  Fly   405 -----GYARSLVFS----KLTTDDLVRNIETLI-NDPQYKRSALEVSQR 443
                 .|.:..:|:    .:|.:|:.|.|..:: .|...:.:..|::::
plant   435 AVEIRKYLKGDLFAGEMETVTAEDIERAIRRVMEQDSDVRNNVKEMAEK 483

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 71/309 (23%)
UDPGT 37..483 CDD:278624 71/309 (23%)
UGT71B5NP_001328018.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.