DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and AT3G46650

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_190249.4 Gene:AT3G46650 / 823818 AraportID:AT3G46650 Length:435 Species:Arabidopsis thaliana


Alignment Length:439 Identity:101/439 - (23%)
Similarity:150/439 - (34%) Gaps:149/439 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 RILFMGPFPAPSHWLWLEHFQNDLLRQGHHVTSVNNHPTKHPHENLTEIIISPSFDIPKHFPKEN 90
            |.:.:.|.||..|...|......|..:|..:|.|..|..:          :|.|   .:|||   
plant     9 RRIVLVPIPAQGHVTPLMQLGKVLNSKGFSITVVEGHFNQ----------VSSS---SQHFP--- 57

  Fly    91 IFSMQFV--------SDFNNL---ELWWTIGLMTTEHAFKDPKVKKLIESKDDHYDLVIIEQFFH 144
              ..|||        |:|..|   |...|:. .|:|.:|||...:.|::..:|      |....:
plant    58 --GFQFVTIKESLPESEFEKLGGIESMITLN-KTSEASFKDCISQLLLQQGND------IACIIY 113

  Fly   145 EAFLMF----GKRFNCPVVTIGTMGYADNIDHAMGILTPWSLIPHLLLSHTDRMTFGQRAYNAYL 205
            :.::.|    .|.|:.|.|...|...|:.:                  ||.|             
plant   114 DEYMYFCGAAAKEFSIPSVIFSTQSAANYV------------------SHPD------------- 147

  Fly   206 SLYDAVMRRWVYLPKMQKLAEKYFQGSIEGPLPNVLDL------ERNISLVLINAHRSID----- 259
             :.|.|:.      .:..|..|....|..|||....:|      :|..|.|:||....::     
plant   148 -MQDKVVE------NLYPLRYKDLPTSGMGPLDRFFELCREVANKRTASAVIINTVSCLESSSLS 205

  Fly   260 -LPRPSMPGLIDVGGAHI---------------------QKPKQLPTDLQNFLDNATYGVIYFSM 302
             |.:.....:..:|..|:                     ||||               .|||.|:
plant   206 WLEQKVGISVYPLGPLHMTDSSPSSLLEEDRSCIEWLNKQKPK---------------SVIYISI 255

  Fly   303 GSYVKSTDLPQEKTALILKAFGQL---KQQVIWKFE------NDSIGDLPSNV--------MIKK 350
            |:      |.|.:|..:|:....|   .|..:|...      .:.|..||.:|        .|.|
plant   256 GT------LGQMETKEVLEMSWGLCNSNQPFLWVIRAGSILGTNGIESLPEDVNKMVSERGYIVK 314

  Fly   351 WMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNTI 399
            ..||.::|.||.|..|.:|.|.....|.|..||||:|.|.:|:|..|.:
plant   315 RAPQIEVLGHPAVGGFWSHCGWNSILESIGEGVPMICKPFHGEQKLNAM 363

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 101/439 (23%)
UDPGT 37..483 CDD:278624 97/428 (23%)
AT3G46650NP_190249.4 Glycosyltransferase_GTB-type 1..435 CDD:385653 101/439 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
33.050

Return to query results.
Submit another query.