DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT71B8

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_188817.1 Gene:UGT71B8 / 821734 AraportID:AT3G21800 Length:480 Species:Arabidopsis thaliana


Alignment Length:425 Identity:88/425 - (20%)
Similarity:148/425 - (34%) Gaps:138/425 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TIGLMTTEHAFKDPKVKKLIESKDDHYDL---------VIIEQFFHEAFLMFGKRFNC-PVVTIG 162
            |:||....|.   |.||:.:....|.|..         ::::.|             | .|:.:.
plant    78 TVGLHVDNHI---PMVKRTVAKLVDDYSRRPDSPRLAGLVVDMF-------------CISVIDVA 126

  Fly   163 T-------MGYADNIDHAMGILTPWSLIPHLLLSHTDRMTFGQRAYNA-------------YLSL 207
            .       :.|..|:    |||   :|..|:      :|.|.::.|:.             ..||
plant   127 NEVSVPCYLFYTSNV----GIL---ALGLHI------QMLFDKKEYSVSETDFEDSEVVLDVPSL 178

  Fly   208 ----------YDAVMRRW--VYLPKMQKLAEKYFQGSIEGPLPNVL-DLERNISLVLINAHRSID 259
                      |....:.|  :||.:.::..|      ::|.|.|.. :||   ...|.:.|.|.|
plant   179 TCPYPVKCLPYGLATKEWLPMYLNQGRRFRE------MKGILVNTFAELE---PYALESLHSSGD 234

  Fly   260 LPRPSMPGLI-----DVGGAHIQKPKQLPTDLQNFLD-NATYGVIYFSMGSYVKSTDLPQEKTAL 318
            .||....|.:     .|.|:..:|    .:|:..:|| .....|::...||.....:....:.|:
plant   235 TPRAYPVGPLLHLENHVDGSKDEK----GSDILRWLDEQPPKSVVFLCFGSIGGFNEEQAREMAI 295

  Fly   319 ILKAFGQLKQQVIW---KFENDSIGDLPSNV-------------------MIKKWMPQNDILAHP 361
            .|:..|   .:.:|   :...|...:||...                   .:..|.||..:||.|
plant   296 ALERSG---HRFLWSLRRASRDIDKELPGEFKNLEEILPEGFFDRTKDKGKVIGWAPQVAVLAKP 357

  Fly   362 NVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNTIKSVRE-----------------GYARS 409
            .:..|:||.|.....|.:::|||:...|||.:|..|....|.|                 |.|..
plant   358 AIGGFVTHCGWNSILESLWFGVPIAPWPLYAEQKFNAFVMVEELGLAVKIRKYWRGDQLVGTATV 422

  Fly   410 LVFSKLTTDDLVRNIETLI-NDPQYKRSALEVSQR 443
            :|    |.:::.|.|..|: .|...:....|:|::
plant   423 IV----TAEEIERGIRCLMEQDSDVRNRVKEMSKK 453

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 88/425 (21%)
UDPGT 37..483 CDD:278624 88/425 (21%)
UGT71B8NP_188817.1 PLN02554 2..480 CDD:215304 88/425 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.