DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and AT3G21790

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_188816.1 Gene:AT3G21790 / 821733 AraportID:AT3G21790 Length:495 Species:Arabidopsis thaliana


Alignment Length:426 Identity:88/426 - (20%)
Similarity:148/426 - (34%) Gaps:136/426 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   108 TIGLMTTEHAFK--DPKVK----KLIE---SKDDHYDLV-------------IIEQFFHEAFLMF 150
            ||.:.|.|...|  :|||:    ||:|   ||.|...:.             :..:|...:::.:
plant    77 TIEMTTIEIHMKNQEPKVRSTVAKLLEDYSSKPDSPKIAGFVLDMFCTSMVDVANEFGFPSYMFY 141

  Fly   151 GKRFNCPVVT-------------IGTMGYADNIDHAMGILT--------PWSLIPHLLLSHTDRM 194
            ........||             :....|||    :..:|.        |...:||.|.::    
plant   142 TSSAGILSVTYHVQMLCDENKYDVSENDYAD----SEAVLNFPSLSRPYPVKCLPHALAAN---- 198

  Fly   195 TFGQRAYNAYLSLYDAVMRRWVYLPKMQKLAEKYFQGSIEGPLPN-VLDLERNISLVLINAHRSI 258
                                 ::||.....|.|:.:  ::|.|.| |.:||..:...|    .|.
plant   199 ---------------------MWLPVFVNQARKFRE--MKGILVNTVAELEPYVLKFL----SSS 236

  Fly   259 DLPRPSMPGLIDVGG-AHIQKPKQLPTD-----LQNFLDNATYGVIYF----SMGSYVKSTDLPQ 313
            |.| |..|    ||. .|::..:....|     :..:||......:.|    |||.:      .:
plant   237 DTP-PVYP----VGPLLHLENQRDDSKDEKRLEIIRWLDQQPPSSVVFLCFGSMGGF------GE 290

  Fly   314 EKTALILKAFGQLKQQVIWKFENDS---IGDLPSNV-------------------MIKKWMPQND 356
            |:...|..|..:...:.:|.....|   ..:||...                   .:..|.||..
plant   291 EQVREIAIALERSGHRFLWSLRRASPNIFKELPGEFTNLEEVLPEGFFDRTKDIGKVIGWAPQVA 355

  Fly   357 ILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNTIKSVRE-GYA------------R 408
            :||:|.:..|:||.|...|.|.:::|||....|||.:|..|....|.| |.|            .
plant   356 VLANPAIGGFVTHCGWNSTLESLWFGVPTAAWPLYAEQKFNAFLMVEELGLAVEIRKYWRGEHLA 420

  Fly   409 SLVFSKLTTDDLVRNIETLI-NDPQYKRSALEVSQR 443
            .|..:.:|.:::.:.|..|: .|...::...::|::
plant   421 GLPTATVTAEEIEKAIMCLMEQDSDVRKRVKDMSEK 456

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 88/426 (21%)
UDPGT 37..483 CDD:278624 88/426 (21%)
AT3G21790NP_188816.1 PLN02554 1..483 CDD:215304 88/426 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.