DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and HYR1

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_188813.1 Gene:HYR1 / 821730 AraportID:AT3G21760 Length:485 Species:Arabidopsis thaliana


Alignment Length:259 Identity:62/259 - (23%)
Similarity:108/259 - (41%) Gaps:60/259 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly   220 KMQKLAEKYFQGSIEGPLPNVLDLERNISLVLINAHRSIDLPRPSMPGLIDVGGAHIQKPKQLPT 284
            :::..|.|:|.| ::.|||.|..:...::| .||...|.|..:..:...:|      ::|::   
plant   225 ELEPQAMKFFSG-VDSPLPTVYTVGPVMNL-KINGPNSSDDKQSEILRWLD------EQPRK--- 278

  Fly   285 DLQNFLDNATYGVIYFSMGSYVKSTDLPQEKTALILKAFGQLKQQVIWKFE----NDSIGD---- 341
                       .|::...||.....:...::.|:.|:..|   .:.:|...    ..|||.    
plant   279 -----------SVVFLCFGSMGGFREGQAKEIAIALERSG---HRFVWSLRRAQPKGSIGPPEEF 329

  Fly   342 ------LPSNVM--------IKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYG 392
                  ||...:        |..|.||:.|||:|.:..|::|.|...|.|.:::||||...|||.
plant   330 TNLEEILPEGFLERTAEIGKIVGWAPQSAILANPAIGGFVSHCGWNSTLESLWFGVPMATWPLYA 394

  Fly   393 DQHRNTIKSVRE-GYARSLVFS-----------KLTTDDLVRNIETLINDPQYKRSAL-EVSQR 443
            :|..|..:.|.| |.|..:..|           .:|.:::.|.|..|:......||.: |:|::
plant   395 EQQVNAFEMVEELGLAVEVRNSFRGDFMAADDELMTAEEIERGIRCLMEQDSDVRSRVKEMSEK 458

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 62/259 (24%)
UDPGT 37..483 CDD:278624 62/259 (24%)
HYR1NP_188813.1 PLN02554 1..485 CDD:215304 62/259 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.