DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT73C6

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_181217.1 Gene:UGT73C6 / 818251 AraportID:AT2G36790 Length:495 Species:Arabidopsis thaliana


Alignment Length:441 Identity:94/441 - (21%)
Similarity:161/441 - (36%) Gaps:124/441 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILFMGPFPAPSHWLWLEHFQNDLLRQGHHVTSVNNHPTKHPH-----ENLTEIIISPSFDIPKHF 86
            :||  ||.|..|.:.:......|.::|..:|.|..     ||     :|:....|.....|    
plant    15 VLF--PFMAQGHMIPMVDIARLLAQRGVLITIVTT-----PHNAARFKNVLNRAIESGLPI---- 68

  Fly    87 PKENIFSMQF-------VSDFNNLELWWTIGLMTT----EHAFKDPKVKKLIESKDDHYDLVIIE 140
               |:..::|       .....|::|..|:..:|:    .:..|:| |:.|||........:|.:
plant    69 ---NLVQVKFPYQEAGLQEGQENMDLLTTMEQITSFFKAVNLLKEP-VQNLIEEMSPRPSCLISD 129

  Fly   141 ---QFFHEAFLMFGKRFNCPVVTIGTMG---------------YADNIDHAMGILTPWSLIPHLL 187
               .:..|    ..|:|..|.:....||               ..||:...    ..:.::|:. 
plant   130 MCLSYTSE----IAKKFKIPKILFHGMGCFCLLCVNVLRKNREILDNLKSD----KEYFIVPYF- 185

  Fly   188 LSHTDRMTFGQRAYNAYLSLYDAVMRRWVYLPKMQKLAEKYFQGSIEGPLPNVLDLERNISLVLI 252
               .||:.|                      .:.|...|.|.....:..|.::::.::....|::
plant   186 ---PDRVEF----------------------TRPQVPVETYVPAGWKEILEDMVEADKTSYGVIV 225

  Fly   253 NAHRSID-----------------LPRPSMPGLIDVGGAHIQKPKQLPTD-LQNFLDNATYG-VI 298
            |:.:.::                 :...|:...:.|..|.......:..| ...:||:...| |:
plant   226 NSFQELEPAYAKDFKEARSGKAWTIGPVSLCNKVGVDKAERGNKSDIDQDECLEWLDSKEPGSVL 290

  Fly   299 YFSMGSYVKSTDLP--------------QEKTALILKAFGQLKQQVIWKFEN---DSIGDLPSNV 346
            |..:||.   .:||              |.....:::.:.:.|:.|.|..|:   |.|.|  ..:
plant   291 YVCLGSI---CNLPLSQLLELGLGLEESQRPFIWVIRGWEKYKELVEWFSESGFEDRIQD--RGL 350

  Fly   347 MIKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRN 397
            :||.|.||..||:||:|..|:||.|...|.|||..|:|||..||:.||..|
plant   351 LIKGWSPQMLILSHPSVGGFLTHCGWNSTLEGITAGLPMLTWPLFADQFCN 401

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 94/441 (21%)
UDPGT 37..483 CDD:278624 89/431 (21%)
UGT73C6NP_181217.1 Glycosyltransferase_GTB-type 12..494 CDD:385653 94/441 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.