DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT73C2

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_181214.1 Gene:UGT73C2 / 818248 AraportID:AT2G36760 Length:496 Species:Arabidopsis thaliana


Alignment Length:544 Identity:113/544 - (20%)
Similarity:196/544 - (36%) Gaps:151/544 - (27%)


- Green bases have known domain annotations that are detailed below.


  Fly    27 ILFMGPFPAPSHWLWLEHFQNDLLRQGHHVTSVNNHPTKHPHENLTEI--IISPSFDIPKHFPKE 89
            :||  ||.|..|.:.:......|.::|..:|.|..     || |....  :::.:.....|...|
plant    16 VLF--PFMAQGHMIPMVDIARILAQRGVTITIVTT-----PH-NAARFKDVLNRAIQSGLHIRVE 72

  Fly    90 NI-FSMQ---FVSDFNNLELWWTIGLMTTEHAFK------DPKVKKLIESKDDHYDLVIIEQFFH 144
            :: |..|   ......|::...::.||.  |.||      :|.:|.:.|.|..  ...:|..|..
plant    73 HVKFPFQEAGLQEGQENVDFLDSMELMV--HFFKAVNMLENPVMKLMEEMKPK--PSCLISDFCL 133

  Fly   145 EAFLMFGKRFNCP-VVTIGTMGYA----------DNIDHAMGILTPWSLIPHLLLSHTDRMTFGQ 198
            .......||||.| :|..|...:.          .||.||:.....:.|:|    |..||:.|  
plant   134 PYTSKIAKRFNIPKIVFHGVSCFCLLSMHILHRNHNILHALKSDKEYFLVP----SFPDRVEF-- 192

  Fly   199 RAYNAYLSLYDAVMRRWVYLPKMQKLAEKYFQGSIEGPLPNVLDLERNISLVLINAHRSIDLPRP 263
                                .|:|...:..|.|..:..:...:|.:.....|::|..:       
plant   193 --------------------TKLQVTVKTNFSGDWKEIMDEQVDADDTSYGVIVNTFQ------- 230

  Fly   264 SMPGLIDVGGAHIQKPKQL---------PTDLQNFL--DNATYG--------------------- 296
                  |:..|:::...:.         |..|.|.:  |.|..|                     
plant   231 ------DLESAYVKNYTEARAGKVWSIGPVSLCNKVGEDKAERGNKAAIDQDECIKWLDSKDVES 289

  Fly   297 VIYFSMGS-------YVKSTDLPQEKT----ALILKAFGQLKQQVIWKFEND-SIGDLPSNVMIK 349
            |:|..:||       .::...|..|.|    ..:::..|:..:...|..|:. .......:::||
plant   290 VLYVCLGSICNLPLAQLRELGLGLEATKRPFIWVIRGGGKYHELAEWILESGFEERTKERSLLIK 354

  Fly   350 KWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRN---TIKSVREGYARSLV 411
            .|.||..||:||.|..|:||.|...|.|||..|||::..||:|||..|   .::.::.|.:    
plant   355 GWSPQMLILSHPAVGGFLTHCGWNSTLEGITSGVPLITWPLFGDQFCNQKLIVQVLKAGVS---- 415

  Fly   412 FSKLTTDDLVR-----NIETLINDPQYKRSALEV-----SQRFRDNPIHPLDEATFWIEYIIRHR 466
               :..:::::     :|..|::....|::..|:     ..:.|...:..|.|        :.|:
plant   416 ---VGVEEVMKWGEEESIGVLVDKEGVKKAVDEIMGESDEAKERRKRVRELGE--------LAHK 469

  Fly   467 GARH-LKSHGAFIPLHQYLLLDVL 489
            .... ..||...|    :||.|::
plant   470 AVEEGGSSHSNII----FLLQDIM 489

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 110/536 (21%)
UDPGT 37..483 CDD:278624 105/526 (20%)
UGT73C2NP_181214.1 Glycosyltransferase_GTB_type 13..495 CDD:299143 113/544 (21%)
YjiC 14..463 CDD:224732 104/504 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.