DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT74D1

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001325305.1 Gene:UGT74D1 / 817732 AraportID:AT2G31750 Length:490 Species:Arabidopsis thaliana


Alignment Length:222 Identity:55/222 - (24%)
Similarity:93/222 - (41%) Gaps:50/222 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly   288 NFLDNATYG-VIYFSMGSYVKSTDLPQEKTALILKAFGQLKQQVIWKFENDSIGDLPSNV----- 346
            ::||:...| |||.|.||.....|....:.|..||..|   ...:|.........||||.     
plant   262 DWLDSKPPGSVIYVSFGSLAVLKDDQMIEVAAGLKQTG---HNFLWVVRETETKKLPSNYIEDIC 323

  Fly   347 ---MIKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNT---------- 398
               :|..|.||..:|||.::..|:||.|...|.|.:..||.::.:|.|.||..|.          
plant   324 DKGLIVNWSPQLQVLAHKSIGCFMTHCGWNSTLEALSLGVALIGMPAYSDQPTNAKFIEDVWKVG 388

  Fly   399 --IKSVREGYARSLVFSKLTTDDLVRNIETLIND-----PQYKRSALEVSQRFRD------NPIH 450
              :|:.:.|:        :..:::||.:..::.|     .:.:::|..:.:..|:      |...
plant   389 VRVKADQNGF--------VPKEEIVRCVGEVMEDMSEKGKEIRKNARRLMEFAREALSDGGNSDK 445

  Fly   451 PLDEATFWIEYIIR----HRGARHLKS 473
            .:||   ::..|:|    :|..|:|.|
plant   446 NIDE---FVAKIVRSIEAYRSGRYLSS 469

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 55/222 (25%)
UDPGT 37..483 CDD:278624 55/222 (25%)
UGT74D1NP_001325305.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I2281
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.