DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT71C1

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_180536.1 Gene:UGT71C1 / 817525 AraportID:AT2G29750 Length:481 Species:Arabidopsis thaliana


Alignment Length:483 Identity:94/483 - (19%)
Similarity:164/483 - (33%) Gaps:163/483 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 PFPAPSHWLWLEHFQNDLLRQGHHVTSVNNHPTKH------------PHENLTEIIISPSFDIPK 84
            |||...|.|........|:.|        ::|..|            |..:....:.|    :.|
plant    13 PFPFSGHILATIELAKRLISQ--------DNPRIHTITILYWGLPFIPQADTIAFLRS----LVK 65

  Fly    85 HFPKENIFSMQFVSDFNNLELWWTIGLMTTEHAFKDPKVKK-----------LIESKDDHYDLVI 138
            :.|:..:.::..|.|...:||:     :....::....|||           |:.|:|:...:.:
plant    66 NEPRIRLVTLPEVQDPPPMELF-----VEFAESYILEYVKKMVPIIREALSTLLSSRDESGSVRV 125

  Fly   139 ---IEQFFHEAFLMFGKRFNCPVVTIGTMGYADNIDHAMGILTPWSLIPHLLLSHTDRMTFGQRA 200
               :..||....:..|..||.|.....|.        :.|.|.....:|.   .|.:..:...|:
plant   126 AGLVLDFFCVPMIDVGNEFNLPSYIFLTC--------SAGFLGMMKYLPE---RHREIKSEFNRS 179

  Fly   201 YNAYLSLY-------------DAVMRRWVYLPKMQKLAEKYFQGSIEGPLPNVLDLERNISLVLI 252
            :|..|:|.             ..:..:..|.|.:: |||::.:.  :|              :|:
plant   180 FNEELNLIPGYVNSVPTKVLPSGLFMKETYEPWVE-LAERFPEA--KG--------------ILV 227

  Fly   253 NAHRSIDLPRPSMPGLIDVGGAHIQKPKQLPTDLQNF---LDNATYGVIYFSMGSYVKSTDLP-- 312
            |::.:::                       |...:.|   .||  |..|| .:|..:.|.|.|  
plant   228 NSYTALE-----------------------PNGFKYFDRCPDN--YPTIY-PIGPILCSNDRPNL 266

  Fly   313 --------------QEKTALILKAFGQLKQ------------------QVIWKFEND------SI 339
                          |.:::::...||.||.                  :.||.|..:      ..
plant   267 DSSERDRIITWLDDQPESSVVFLCFGSLKNLSATQINEIAQALEIVDCKFIWSFRTNPKEYASPY 331

  Fly   340 GDLPSNVM--------IKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHR 396
            ..||...|        :..|.||.:||||..|..|::|.|.....|.:.:|||:...|:|.:|..
plant   332 EALPHGFMDRVMDQGIVCGWAPQVEILAHKAVGGFVSHCGWNSILESLGFGVPIATWPMYAEQQL 396

  Fly   397 NTIKSVRE-GYARSLVFSKLTTD-DLVR 422
            |....|:| |.|..:....::.| |:|:
plant   397 NAFTMVKELGLALEMRLDYVSEDGDIVK 424

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 94/483 (19%)
UDPGT 37..483 CDD:278624 91/478 (19%)
UGT71C1NP_180536.1 PLN02167 4..478 CDD:215112 94/483 (19%)
MGT 14..465 CDD:273616 93/482 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.