DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT71C2

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_180535.1 Gene:UGT71C2 / 817524 AraportID:AT2G29740 Length:474 Species:Arabidopsis thaliana


Alignment Length:520 Identity:101/520 - (19%)
Similarity:169/520 - (32%) Gaps:184/520 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    25 SRILFMGPFPAPSHWLWLEHFQNDLLRQGHHVTSVNNHPTKH------PH-------------EN 70
            :.::|: |||.|.|.|........|:  .|..:.::.....|      |.             |:
plant     7 AELIFI-PFPIPGHILATIELAKRLI--SHQPSRIHTITILHWSLPFLPQSDTIAFLKSLIETES 68

  Fly    71 LTEIIISPSFDIPKHFPKENIF---SMQFVSDFNNLELWWTIGLMTTEHAFKDPKVKKLIE---- 128
            ...:|..|....|   |...:|   |..::.::                      |||::.    
plant    69 RIRLITLPDVQNP---PPMELFVKASESYILEY----------------------VKKMVPLVRN 108

  Fly   129 ------SKDDHYDLV----IIEQFFHEAFLMFGKRFNCPVV------------------------ 159
                  |..|..|.|    ::..||....:..|..||.|..                        
plant   109 ALSTLLSSRDESDSVHVAGLVLDFFCVPLIDVGNEFNLPSYIFLTCSASFLGMMKYLLERNRETK 173

  Fly   160 ----------TIGTMGYADNIDHAMGILTPWSLIPHLLLSHTDRMTFGQRAYNAYLSLYDAVMRR 214
                      ||...|:.:::        |..::|..|        |...:|.|           
plant   174 PELNRSSDEETISVPGFVNSV--------PVKVLPPGL--------FTTESYEA----------- 211

  Fly   215 WVYLPKMQKLAEKYFQGSIEGPLPNVLD-LERNISLVLINAHRSIDLPRPSMPGLIDVGGAHIQK 278
            ||      ::||::.:.  :|.|.|..: |||       ||....|....:.|.:..:|      
plant   212 WV------EMAERFPEA--KGILVNSFESLER-------NAFDYFDRRPDNYPPVYPIG------ 255

  Fly   279 PKQLPTDLQN-----------FLDN-ATYGVIYFSMGSYVKSTDLPQEKTALILKAFGQLKQQVI 331
            |.....|..|           :||: ....|::...|| :||....|.|.  |.:|...:..:.:
plant   256 PILCSNDRPNLDLSERDRILKWLDDQPESSVVFLCFGS-LKSLAASQIKE--IAQALELVGIRFL 317

  Fly   332 WKFEND-----SIGD-LPSNVM--------IKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWG 382
            |....|     |..: ||...|        :..|.||.:||||..:..|::|.|.....|.:.:|
plant   318 WSIRTDPKEYASPNEILPDGFMNRVMGLGLVCGWAPQVEILAHKAIGGFVSHCGWNSILESLRFG 382

  Fly   383 VPMLCVPLYGDQHRNTIKSVRE-GYARSLVFSKLT-------TDDLVRNIETLINDPQYKRSALE 439
            ||:...|:|.:|..|....|:| |.|..:....::       .|::...:.:|::.....|..|:
plant   383 VPIATWPMYAEQQLNAFTIVKELGLALEMRLDYVSEYGEIVKADEIAGAVRSLMDGEDVPRRKLK 447

  Fly   440  439
            plant   448  447

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 101/520 (19%)
UDPGT 37..483 CDD:278624 96/508 (19%)
UGT71C2NP_180535.1 PLN02167 4..474 CDD:215112 101/520 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.