DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and AT2G18560

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_179446.2 Gene:AT2G18560 / 816371 AraportID:AT2G18560 Length:380 Species:Arabidopsis thaliana


Alignment Length:322 Identity:77/322 - (23%)
Similarity:117/322 - (36%) Gaps:103/322 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   187 LLSHTDRMTFGQRAYNAYLSLYDAVMRRWVYLPKMQKLAEKYFQGSIE----------GPLPNVL 241
            |||.||   .|..:...|:..:...:...||||.:.|:.|..:....|          || ..:|
plant    31 LLSITD---VGVTSKYVYIPSHAWFLALIVYLPVLDKVMEGEYVDIKEPMKIPGCKPVGP-KELL 91

  Fly   242 D--LERN---------ISL-------VLINA------------HRSIDLPR----PSMP-GLIDV 271
            |  |:|:         |.|       ||:|.            ...|||.|    |..| |.|..
plant    92 DTMLDRSDQQYRDCVQIGLEIPMSDGVLVNTWGELQGKTLAALREDIDLNRVIKVPVYPIGPIVR 156

  Fly   272 GGAHIQKPKQLPTDLQNFLDNATY---------GVIYFSMGSYVKSTDLPQEKTALILKAFGQLK 327
            ....|:||            |:|:         .|:|..:||   ...|..|:|..:........
plant   157 TNVLIEKP------------NSTFEWLDKQEERSVVYVCLGS---GGTLSFEQTMELAWGLELSC 206

  Fly   328 QQVIWKF------------ENDSIGD-LPS---------NVMIKKWMPQNDILAHPNVKLFITHG 370
            |..:|..            ::|.:.| ||.         .:::.:|.||.:||:|.::..|::|.
plant   207 QSFLWVLRKPPSYLGASSKDDDQVSDGLPEGFLDRTRGVGLVVTQWAPQVEILSHRSIGGFLSHC 271

  Fly   371 GIFGTQEGIYWGVPMLCVPLYGDQHRN-TIKSVREGYA-------RSLVFSKLTTDDLVRNI 424
            |.....|.:..|||::..|||.:|..| |:.:...|.|       ...|.|:.....||:.|
plant   272 GWSSVLESLTKGVPIIAWPLYAEQWMNATLLTEEIGMAIRTSELPSKKVISREEVASLVKKI 333

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 77/322 (24%)
UDPGT 37..483 CDD:278624 77/322 (24%)
AT2G18560NP_179446.2 Glycosyltransferase_GTB_type 1..380 CDD:299143 77/322 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.