DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and UGT73B5

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_001189528.1 Gene:UGT73B5 / 816040 AraportID:AT2G15480 Length:494 Species:Arabidopsis thaliana


Alignment Length:240 Identity:65/240 - (27%)
Similarity:100/240 - (41%) Gaps:47/240 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly   237 LPNVLDLERNISLVLINA-----------HRSIDLPRPSMPGLIDVG----GAHIQKPKQLPTDL 286
            :..|.:.|.|...||:|:           :||....|....|.:.:.    |...::.|:...|.
plant   211 MKEVRESETNSFGVLVNSFYELESAYADFYRSFVAKRAWHIGPLSLSNRELGEKARRGKKANIDE 275

  Fly   287 Q---NFLDNATYG-VIYFSMGSYVKSTDLPQEKTALILKAFGQLKQQVIWKF-ENDSIGD----L 342
            |   .:||:.|.| |:|.|.||....|:....:.|..|:..|   |..||.. :|::.||    |
plant   276 QECLKWLDSKTPGSVVYLSFGSGTNFTNDQLLEIAFGLEGSG---QSFIWVVRKNENQGDNEEWL 337

  Fly   343 P---------SNVMIKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRN- 397
            |         ..::|..|.||..||.|..:..|:||.|.....|||..|:||:..|:..:|..| 
plant   338 PEGFKERTTGKGLIIPGWAPQVLILDHKAIGGFVTHCGWNSAIEGIAAGLPMVTWPMGAEQFYNE 402

  Fly   398 --TIKSVREGYARSLVFSKLTTDDLVRNIETLINDPQYKRSALEV 440
              ..|.:|.|.       .:...:||:. ..||:..|.:::..||
plant   403 KLLTKVLRIGV-------NVGATELVKK-GKLISRAQVEKAVREV 439

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 65/240 (27%)
UDPGT 37..483 CDD:278624 65/240 (27%)
UGT73B5NP_001189528.1 PLN03007 4..494 CDD:178584 65/240 (27%)
MGT 14..456 CDD:273616 65/240 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 76 1.000 Domainoid score I3136
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.000

Return to query results.
Submit another query.