DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and Ugt3a2

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:XP_038959826.1 Gene:Ugt3a2 / 294793 RGDID:1564365 Length:454 Species:Rattus norvegicus


Alignment Length:440 Identity:122/440 - (27%)
Similarity:200/440 - (45%) Gaps:50/440 - (11%)


- Green bases have known domain annotations that are detailed below.


  Fly   121 PKVKKLIESKDDHYDLVIIEQFF---------HEAFLMFGKRFNCPVVTIGTMGYADN------- 169
            |:..||.:.:.:|:.:|.|.:.|         .:..:.|.|..|..:|...::.|..:       
  Rat    25 PQKVKLNKLQFEHHTIVKIHRHFGDLCNHLLSRKDIMEFLKNANFDLVLFESVDYCSSLIVEKLG 89

  Fly   170 ------IDHAMGIL------TPWSLIPHLLLSHTDRMTFGQRAYNAYLSLYDAVMRRWVYLPKMQ 222
                  :...:|.:      .|.|.:|......||:|.|..|..| :|..:|...::...|.:..
  Rat    90 KQFVLFLAFQLGFMDFELQRVPLSYVPVYGSGLTDQMDFWGRVKN-FLMFFDLSRKQREILSQYD 153

  Fly   223 KLAEKYFQGSIEGPLPNVLDLERNISLVLINAHRSIDLPRPSMPGLIDVGGAHIQKPKQ-LPTDL 286
            ...:::|   .||..|.:.||.....|..:|...:.:..||..|.::.|||. :.||.| :|.||
  Rat   154 STIQEHF---AEGSRPVLSDLLLKAELWFVNCDFAFEFARPLFPNIVYVGGL-LDKPVQSIPQDL 214

  Fly   287 QNFLDN-ATYGVIYFSMGSYVKSTDLPQEKTALILK----AFGQLKQQVIWKFEND---SIGDLP 343
            :||:.. ...|.:..::|     |...:.:|..|:|    ||..|.|.|||..::.   ....|.
  Rat   215 ENFITQFGDSGFVLVALG-----TVATKFQTKEIIKEMNNAFAHLPQGVIWACKDSHWPKDVTLA 274

  Fly   344 SNVMIKKWMPQNDILAHPNVKLFITHGGIFGTQEGIYWGVPMLCVPLYGDQHRNTIKSVREGYAR 408
            .||.|..|:||.|:||||:::||:||||:....|.|..||||:.:..:.||..|.|:...:....
  Rat   275 PNVKIMDWLPQTDLLAHPSIRLFVTHGGMNSVNEAIQHGVPMVGILFFSDQPENMIRVEAKTIGV 339

  Fly   409 SLVFSKLTTDDLVRNIETLINDPQYKRSALEVSQRFRDNPIHPLDEATFWIEYIIRHRGARHLKS 473
            |:....|..:...|.::.:|.|.:||.:|:........:|:.|......||::|::..||.|||.
  Rat   340 SIQIQTLKAETFARTMKEVIEDKRYKSAAMASKIIRHSHPLTPSQRLEGWIDHILQTGGAAHLKP 404

  Fly   474 HGAFIPLHQYLLLDVLGCLLLGAFL-AIWLPWRMIRRVHKWWLKGESSNK 522
            :....|.|:..||||. ..|||..| .:||..:::..|.: :|.|....|
  Rat   405 YAFQQPWHEQYLLDVF-LFLLGLTLGTVWLCVKVLGAVMR-YLSGARKAK 452

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 108/398 (27%)
UDPGT 37..483 CDD:278624 108/398 (27%)
Ugt3a2XP_038959826.1 Glycosyltransferase_GTB-type 49..419 CDD:415824 103/379 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X13
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.900

Return to query results.
Submit another query.