DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ugt301D1 and Y43D4A.2

DIOPT Version :9

Sequence 1:NP_001246079.1 Gene:Ugt301D1 / 35105 FlyBaseID:FBgn0032684 Length:530 Species:Drosophila melanogaster
Sequence 2:NP_502984.3 Gene:Y43D4A.2 / 189851 WormBaseID:WBGene00012788 Length:151 Species:Caenorhabditis elegans


Alignment Length:89 Identity:24/89 - (26%)
Similarity:42/89 - (47%) Gaps:13/89 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   124 KKLIESKD-------DHYDLVIIEQFFHEAFLMFGK---RFNCPVVTIGTMGYADNIDHAMGILT 178
            :|::|.|:       :::||.|.|.|...|..:|..   |.:..|::...:   |::..|:|...
 Worm    24 RKVLEDKELIERLRAENFDLAITEPFDTCANALFEAIKIRAHVAVLSCSRL---DHVSKAIGQPI 85

  Fly   179 PWSLIPHLLLSHTDRMTFGQRAYN 202
            ..|.:|....:|.:|||..||..|
 Worm    86 APSYLPGTQSTHGERMTIWQRFMN 109

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ugt301D1NP_001246079.1 egt 12..483 CDD:223071 24/89 (27%)
UDPGT 37..483 CDD:278624 24/89 (27%)
Y43D4A.2NP_502984.3 UDPGT 14..>120 CDD:278624 24/89 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0000004
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100052
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.900

Return to query results.
Submit another query.