DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2r and Nutf2

DIOPT Version :9

Sequence 1:NP_609878.1 Gene:Ntf-2r / 35101 FlyBaseID:FBgn0032680 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001344158.1 Gene:Nutf2 / 68051 MGIID:1915301 Length:127 Species:Mus musculus


Alignment Length:122 Identity:53/122 - (43%)
Similarity:75/122 - (61%) Gaps:3/122 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQGAPKILEKVQSLSFQKIARVI 71
            :|.||..|:|.||.:||:...:...| :.:|  |.:|:||.|.||...|:||:.||.||||...|
Mouse     7 WEQIGSSFIQHYYQLFDNDRTQLGAI-YIDA--SCLTWEGQQFQGKAAIVEKLSSLPFQKIQHSI 68

  Fly    72 TTVDSQPTSDGGVLIIVLGRLKCDDDPPHAFSQIFLLKPNGGSLFVAHDIFRLNIHN 128
            |..|.|||.|..::.:|:|:||.|:||...|.|:||||....:....:|:|||.:||
Mouse    69 TAQDHQPTPDSCIISMVVGQLKADEDPIMGFHQMFLLKNINDAWVCTNDMFRLALHN 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2rNP_609878.1 NTF2 6..125 CDD:238403 50/117 (43%)
Nutf2NP_001344158.1 NTF2 7..122 CDD:238403 50/117 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C167837180
Domainoid 1 1.000 91 1.000 Domainoid score I7676
eggNOG 1 0.900 - - E1_KOG2104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110745
Inparanoid 1 1.050 99 1.000 Inparanoid score I4989
Isobase 1 0.950 - 0 Normalized mean entropy S959
OMA 1 1.010 - - QHG54157
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - otm42413
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1539
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.710

Return to query results.
Submit another query.