DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2r and nutf2

DIOPT Version :9

Sequence 1:NP_609878.1 Gene:Ntf-2r / 35101 FlyBaseID:FBgn0032680 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001011126.1 Gene:nutf2 / 496540 XenbaseID:XB-GENE-952887 Length:127 Species:Xenopus tropicalis


Alignment Length:123 Identity:55/123 - (44%)
Similarity:74/123 - (60%) Gaps:5/123 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YEDIGKEFVQQYYAIFDDPANRENVINFYNATD-SFMTFEGNQIQGAPKILEKVQSLSFQKIARV 70
            :|.||..|:||||..||  .:|..:...|  || |.:|:||.|..|...|:||:..|.||||...
 Frog     7 WEQIGSSFIQQYYQTFD--TDRTQLAVIY--TDASCLTWEGQQYHGKAAIVEKLSMLPFQKIQHS 67

  Fly    71 ITTVDSQPTSDGGVLIIVLGRLKCDDDPPHAFSQIFLLKPNGGSLFVAHDIFRLNIHN 128
            ||:.|.|||.|..::.:|:|:||.||||...|.|:||||....:....:|:|||.:||
 Frog    68 ITSQDHQPTPDSCIISMVVGQLKADDDPIMGFHQVFLLKNIQDAWVCTNDMFRLALHN 125

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2rNP_609878.1 NTF2 6..125 CDD:238403 52/118 (44%)
nutf2NP_001011126.1 NTF2 7..122 CDD:238403 52/118 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 89 1.000 Domainoid score I7733
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110745
Inparanoid 1 1.050 97 1.000 Inparanoid score I4896
OMA 1 1.010 - - QHG54157
OrthoDB 1 1.010 - - D1437819at2759
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - otm47522
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1539
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
1111.080

Return to query results.
Submit another query.