DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2r and Ntf-2

DIOPT Version :9

Sequence 1:NP_609878.1 Gene:Ntf-2r / 35101 FlyBaseID:FBgn0032680 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001259750.1 Gene:Ntf-2 / 33078 FlyBaseID:FBgn0031145 Length:130 Species:Drosophila melanogaster


Alignment Length:130 Identity:114/130 - (87%)
Similarity:120/130 - (92%) Gaps:0/130 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MSLNLQYEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQGAPKILEKVQSLSFQ 65
            ||||.|||||||.|||||||||||||||.||:|||:||||||||||:||||||||||||||||||
  Fly     1 MSLNPQYEDIGKGFVQQYYAIFDDPANRANVVNFYSATDSFMTFEGHQIQGAPKILEKVQSLSFQ 65

  Fly    66 KIARVITTVDSQPTSDGGVLIIVLGRLKCDDDPPHAFSQIFLLKPNGGSLFVAHDIFRLNIHNSA 130
            ||.|||||||||||.||||||.|||||:|||||||||||:|.||.|.|:.|||||||||||||||
  Fly    66 KITRVITTVDSQPTFDGGVLINVLGRLQCDDDPPHAFSQVFFLKANAGTFFVAHDIFRLNIHNSA 130

  Fly   131  130
              Fly   131  130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2rNP_609878.1 NTF2 6..125 CDD:238403 103/118 (87%)
Ntf-2NP_001259750.1 NTF2 6..125 CDD:238403 103/118 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45449280
Domainoid 1 1.000 87 1.000 Domainoid score I2740
eggNOG 1 0.900 - - E1_KOG2104
Homologene 1 1.000 - - H110745
Inparanoid 1 1.050 90 1.000 Inparanoid score I2276
Isobase 1 0.950 - 0 Normalized mean entropy S959
OMA 1 1.010 - - QHG54157
OrthoDB 1 1.010 - - D120996at33392
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - mtm6543
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - P PTHR12612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1539
1413.760

Return to query results.
Submit another query.