DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2r and nxt2

DIOPT Version :9

Sequence 1:NP_609878.1 Gene:Ntf-2r / 35101 FlyBaseID:FBgn0032680 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_001342808.1 Gene:nxt2 / 2542783 PomBaseID:SPAC15F9.03c Length:123 Species:Schizosaccharomyces pombe


Alignment Length:121 Identity:47/121 - (38%)
Similarity:76/121 - (62%) Gaps:5/121 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 YEDIGKEFVQQYYAIFDDPANRENVINFYNATDSFMTFEGNQIQGAPKILEKVQSLSFQKIARVI 71
            |..:..:|.|.||..||  ::|..:.:.|. .:|.::|||.|:||...|:||:.||.||::...|
pombe     4 YNALATQFTQFYYQTFD--SDRSQLSSLYR-EESMLSFEGAQLQGTKAIVEKLVSLPFQRVQHRI 65

  Fly    72 TTVDSQPT-SDGGVLIIVLGRLKCDDDP-PHAFSQIFLLKPNGGSLFVAHDIFRLN 125
            :|:|:||| :.|.|:::|.|.|..|::. ...:||:|.|..|.|:.:|.:|:||||
pombe    66 STLDAQPTGTTGSVIVMVTGELLLDEEQMAQRYSQVFHLVNNNGNYYVLNDLFRLN 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2rNP_609878.1 NTF2 6..125 CDD:238403 45/119 (38%)
nxt2NP_001342808.1 NTF2 3..122 CDD:238403 47/121 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 81 1.000 Domainoid score I2307
eggNOG 1 0.900 - - E1_KOG2104
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H110745
Inparanoid 1 1.050 86 1.000 Inparanoid score I1790
OMA 1 1.010 - - QHG54157
OrthoFinder 1 1.000 - - FOG0002333
OrthoInspector 1 1.000 - - otm46997
orthoMCL 1 0.900 - - OOG6_101526
Panther 1 1.100 - - O PTHR12612
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1539
TreeFam 1 0.960 - -
1312.830

Return to query results.
Submit another query.