DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Ntf-2r and nxt3

DIOPT Version :9

Sequence 1:NP_609878.1 Gene:Ntf-2r / 35101 FlyBaseID:FBgn0032680 Length:130 Species:Drosophila melanogaster
Sequence 2:NP_596518.1 Gene:nxt3 / 2541364 PomBaseID:SPBP8B7.11 Length:434 Species:Schizosaccharomyces pombe


Alignment Length:122 Identity:44/122 - (36%)
Similarity:63/122 - (51%) Gaps:10/122 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 EDIGKEFVQQYYAIFDDPANRENVINFYNATDSFM-TFEGNQI---QGAPKILEKVQSLSFQKIA 68
            ::||..|||:||...:...||.:.  ||....:.: ..||..|   .|..:|..|:..|.||...
pombe    16 DEIGWMFVQEYYTYLNKEPNRLHC--FYTKKSTLIHGDEGESISLCHGQQEIHNKILDLDFQNCK 78

  Fly    69 RVITTVDSQPTSDGGVLIIVLGRLKCDDDPPHAFSQIFLL--KPNGGSLFVAHDIFR 123
            .:|:.|||..:|:||::|.|||.:.........|:|.|.|  :|||  .||.:||||
pombe    79 VLISNVDSLASSNGGIVIQVLGEMSNKGKLSRKFAQTFFLAEQPNG--YFVLNDIFR 133

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Ntf-2rNP_609878.1 NTF2 6..125 CDD:238403 44/122 (36%)
nxt3NP_596518.1 NTF2 16..134 CDD:238403 44/122 (36%)
RRM <308..>420 CDD:223796
RRM_6 317..380 CDD:290958
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
21.870

Return to query results.
Submit another query.