DRSC - DRSC Integrative Ortholog Prediction Tool

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits

Protein Alignment APP and CG10031

DIOPT Version :9

Sequence 1:	NP_000475.1	Gene:	APP / 351	HGNCID:	620	Length:	770	Species:	Homo sapiens
Sequence 2:	NP_608802.2	Gene:	CG10031 / 33594	FlyBaseID:	FBgn0031563	Length:	129	Species:	Drosophila melanogaster

Alignment Length:	71	Identity:	23/71 - (32%)
Similarity:	34/71 - (47%)	Gaps:	3/71 - (4%)

- Green bases have known domain annotations that are detailed below.

Human   271 SIATTTTTTTESVEEVVREVCSEQAETGPCRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEE 335
            ::||||......|.:   ..|.:..:.||||..:.|:|::.....|..|.||||.||.|.:...:
  Fly    58 AVATTTIKPQRLVPD---PKCLQPLDVGPCRMSLERFYYNKDSKACETFKYGGCRGNDNRWGFRQ 119

Human   336 YCMAVC 341
            .|...|
  Fly   120 TCEEAC 125

Known Domains:

Indicated by green bases in alignment.

Gene	Sequence	Domain	Region	External ID	Identity
APP	NP_000475.1	A4_EXTRA	24..188	CDD:128326
		GFLD subdomain. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01217	28..123
		Heparin-binding. /evidence=ECO:0000269\|PubMed:8158260	96..110
		CuBD subdomain. /evidence=ECO:0000255\|PROSITE-ProRule:PRU01217	131..189
		Zinc-binding	181..188
		Disordered. /evidence=ECO:0000256\|SAM:MobiDB-lite	194..284		4/12 (33%)
		Kunitz_BPTI	294..341	CDD:333766	16/46 (35%)
		OX-2. /evidence=ECO:0000269\|PubMed:2649245	344..365
		APP_E2	366..548	CDD:372388
		Heparin-binding	391..423
		Heparin-binding	491..522
		Collagen-binding. /evidence=ECO:0000269\|PubMed:8576160	523..540
		Beta-APP	677..713	CDD:367525
		Interaction with PSEN1. /evidence=ECO:0000269\|PubMed:30630874	695..722
		APP_amyloid	716..766	CDD:371108
		Basolateral sorting signal	724..734
		Interaction with G(o)-alpha	732..751
		Required for the interaction with KIF5B and for anterograde transport in axons. /evidence=ECO:0000269\|PubMed:17062754	756..770
		YENPXY motif, contains endocytosis signal. /evidence=ECO:0000269\|PubMed:10383380	757..762
CG10031	NP_608802.2	Kunitz_BPTI	75..125	CDD:278443	17/49 (35%)
Blue background indicates that the domain is not in the aligned region.

Information from Original Tools:

Tool	Simple Score	Weighted Score	Original Tool Information
Tool	Simple Score	Weighted Score	BLAST Result	Score	Score Type	Cluster ID
Compara	0	0.000	Not matched by this tool.
Domainoid	0	0.000	Not matched by this tool.
eggNOG	1	0.900	-	-		E1_KOG4295
Hieranoid	0	0.000	Not matched by this tool.
Homologene	0	0.000	Not matched by this tool.
Inparanoid	0	0.000	Not matched by this tool.
Isobase	0	0.000	Not matched by this tool.
OMA	0	0.000	Not matched by this tool.
OrthoDB	0	0.000	Not matched by this tool.
OrthoFinder	0	0.000	Not matched by this tool.
OrthoInspector	0	0.000	Not matched by this tool.
orthoMCL	0	0.000	Not matched by this tool.
Panther	0	0.000	Not matched by this tool.
Phylome	1	0.910	-	-
RoundUp	0	0.000	Not matched by this tool.
SonicParanoid	0	0.000	Not matched by this tool.
SwiftOrtho	0	0.000	Not matched by this tool.
TreeFam	0	0.000	Not matched by this tool.
User_Submission	0	0.000	Not matched by this tool.
	2	1.810