DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment APP and CG16713

DIOPT Version :10

Sequence 1:NP_000475.1 Gene:APP / 351 HGNCID:620 Length:770 Species:Homo sapiens
Sequence 2:NP_608799.1 Gene:CG16713 / 33591 FlyBaseID:FBgn0031560 Length:82 Species:Drosophila melanogaster


Alignment Length:42 Identity:19/42 - (45%)
Similarity:23/42 - (54%) Gaps:0/42 - (0%)


- Green bases have known domain annotations that are detailed below.


Human   300 CRAMISRWYFDVTEGKCAPFFYGGCGGNRNNFDTEEYCMAVC 341
            |.|.|..|.:|....:|..|.|||||||.|.|::.|.|...|
  Fly    39 CEAYIPSWSYDADRNECVKFIYGGCGGNNNRFNSREICEDKC 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
APPNP_000475.1 A4_EXTRA 24..188 CDD:128326
GFLD subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01217 28..123
CuBD subdomain. /evidence=ECO:0000255|PROSITE-ProRule:PRU01217 131..189
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 194..284
Kunitz_ABPP-like 294..341 CDD:438650 18/40 (45%)
OX-2. /evidence=ECO:0000269|PubMed:2649245 344..365
APP_E2 366..548 CDD:463752
Heparin-binding 391..423
Heparin-binding 491..522
Collagen-binding. /evidence=ECO:0000269|PubMed:8576160 523..540
JMTM_Notch_APP 693..767 CDD:425406
Interaction with PSEN1. /evidence=ECO:0000269|PubMed:30630874 695..722
Basolateral sorting signal 724..734
Interaction with G(o)-alpha 732..751
Required for the interaction with KIF5B and for anterograde transport in axons. /evidence=ECO:0000269|PubMed:17062754 756..770
YENPXY motif, contains endocytosis signal. /evidence=ECO:0000269|PubMed:10383380 757..762
CG16713NP_608799.1 Kunitz_SCI-I-like 24..80 CDD:438677 18/40 (45%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.