DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment ncm and AT1G52325

DIOPT Version :9

Sequence 1:NP_609877.2 Gene:ncm / 35099 FlyBaseID:FBgn0086707 Length:1330 Species:Drosophila melanogaster
Sequence 2:NP_683421.1 Gene:AT1G52325 / 841663 AraportID:AT1G52325 Length:145 Species:Arabidopsis thaliana


Alignment Length:265 Identity:72/265 - (27%)
Similarity:103/265 - (38%) Gaps:122/265 - (46%)


- Green bases have known domain annotations that are detailed below.


  Fly   721 SSLDYEECAHKLMKMQLKPGQEIELCHMFLDCCAEQRTYEKFYGLLAQRFCNINKIYIPPFEEIF 785
            ||||:||..|||:|::|:.||.:|||.|.|:||.|::||..||                      
plant     2 SSLDFEEAGHKLLKIRLEQGQGMELCVMVLECCTEEKTYRSFY---------------------- 44

  Fly   786 KDTYQTTHRLDTNRLRNVSKFFAHLLFTDAISWDVLECIQLNEDDTTSSSRIFIKILFQELAEYM 850
                                                      .:|:||||.||:|.||.:|:|.:
plant    45 ------------------------------------------VEDSTSSSLIFLKTLFLQLSELL 67

  Fly   851 GLGKLNAKLKDDVLVESIAGLFPKDNPRNTRFSINFFTSIGLGGLTDDLRRFLKNAPKSVPAINA 915
            .:..||.||:|..:.|:...:||||:.:||.|||.|||.|||||:|..||:.:            
plant    68 RIKLLNEKLQDPTMEETFESIFPKDHRKNTLFSIIFFTKIGLGGITQTLRQLI------------ 120

  Fly   916 EILANAGGNPFRDGSAPAGNTKVAPSSSSSSSSSSDTDSEDSSEEDSSSDSSSESSSSDSSSEPK 980
                                           :...:|||||...::...               |
plant   121 -------------------------------AKRKETDSEDELRDEMVM---------------K 139

  Fly   981 KKRKR 985
            ::|||
plant   140 RRRKR 144

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
ncmNP_609877.2 MIF4G 421..602 CDD:214713
MA3 711..817 CDD:280933 25/95 (26%)
PHA02896 <1107..1300 CDD:165222
AT1G52325NP_683421.1 MA3 2..>44 CDD:295416 23/41 (56%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG2140
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.