DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and RPS26A

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_011326.1 Gene:RPS26A / 852686 SGDID:S000003157 Length:119 Species:Saccharomyces cerevisiae


Alignment Length:116 Identity:71/116 - (61%)
Similarity:85/116 - (73%) Gaps:8/116 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLP 65
            |.|||.:.||||..|||||||||.||::.:|||||||:..||||||||||||::|||::..|.||
Yeast     1 MPKKRASNGRNKKGRGHVKPVRCVNCSKSIPKDKAIKRMAIRNIVEAAAVRDLSEASVYPEYALP 65

  Fly    66 KLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLRS--------FPKDMAR 108
            |.|.|||||||||||:::||.||||.|:.|.||.|.        .|.|.|:
Yeast    66 KTYNKLHYCVSCAIHARIVRVRSREDRKNRAPPQRPRFNRENKVSPADAAK 116

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 69/111 (62%)
RPS26ANP_011326.1 Ribosomal_S26e 1..104 CDD:396032 68/102 (67%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C157343195
Domainoid 1 1.000 149 1.000 Domainoid score I946
eggNOG 1 0.900 - - E1_COG4830
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37420
Inparanoid 1 1.050 149 1.000 Inparanoid score I1133
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62164
OrthoFinder 1 1.000 - - FOG0001237
OrthoInspector 1 1.000 - - otm46899
orthoMCL 1 0.900 - - OOG6_100814
Panther 1 1.100 - - LDO PTHR12538
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1241
SonicParanoid 1 1.000 - - X694
TreeFam 1 0.960 - -
1514.790

Return to query results.
Submit another query.