DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and AT2G40590

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_181591.1 Gene:AT2G40590 / 818654 AraportID:AT2G40590 Length:131 Species:Arabidopsis thaliana


Alignment Length:100 Identity:73/100 - (73%)
Similarity:85/100 - (85%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLP 65
            ||.|||||||||||||||.|:||:||.:|.|||||||:|::|||||.||:||:.|||:::.|.||
plant     1 MTFKRRNGGRNKHNRGHVNPIRCSNCGKCCPKDKAIKRFIVRNIVEQAAIRDVQEASVYEGYTLP 65

  Fly    66 KLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR 100
            |||||..|||||||||.|||.|||..||:||||.|
plant    66 KLYAKTQYCVSCAIHSHVVRVRSRTNRRVRTPPPR 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 72/99 (73%)
AT2G40590NP_181591.1 PLN00186 1..109 CDD:215093 72/99 (73%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 166 1.000 Domainoid score I1200
eggNOG 1 0.900 - - E1_COG4830
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37420
Inparanoid 1 1.050 166 1.000 Inparanoid score I1574
OMA 1 1.010 - - QHG62164
OrthoDB 1 1.010 - - D1591366at2759
OrthoFinder 1 1.000 - - FOG0001237
OrthoInspector 1 1.000 - - otm2639
orthoMCL 1 0.900 - - OOG6_100814
Panther 1 1.100 - - O PTHR12538
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X694
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1413.840

Return to query results.
Submit another query.