DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and Rps26l4

DIOPT Version :10

Sequence 1:NP_523595.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_038967442.1 Gene:Rps26l4 / 688948 RGDID:1582959 Length:115 Species:Rattus norvegicus


Alignment Length:107 Identity:82/107 - (76%)
Similarity:89/107 - (83%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLP 65
            |||||||.|..|....||:|:.|||||||||||||||||||||||||||||||:||.::|:||||
  Rat     1 MTKKRRNNGCAKKGHSHVQPICCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEAGVFDTYVLP 65

  Fly    66 KLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLRSFPKDMA 107
            |||.|||||||||||||||||||.|||:.||||.|..|...|
  Rat    66 KLYVKLHYCVSCAIHSKVVRNRSCEARKDRTPPPRFRPAGAA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_523595.1 Ribosomal_S26e 1..104 CDD:426179 80/102 (78%)
Rps26l4XP_038967442.1 Ribosomal_S26e 1..101 CDD:426179 79/99 (80%)

Return to query results.
Submit another query.