DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and RPS26

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001020.2 Gene:RPS26 / 6231 HGNCID:10414 Length:115 Species:Homo sapiens


Alignment Length:107 Identity:88/107 - (82%)
Similarity:95/107 - (88%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLP 65
            |||||||.||.|..||||:|:||||||||||||||||||||||||||||||||:|||::|:||||
Human     1 MTKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLP 65

  Fly    66 KLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLRSFPKDMA 107
            |||.|||||||||||||||||||||||:.||||.|..|...|
Human    66 KLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 87/103 (84%)
RPS26NP_001020.2 Ribosomal_S26e 1..101 CDD:396032 85/99 (86%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 85..115 15/23 (65%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 182 1.000 Domainoid score I3467
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37420
Inparanoid 1 1.050 183 1.000 Inparanoid score I3977
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62164
OrthoDB 1 1.010 - - D1591366at2759
OrthoFinder 1 1.000 - - FOG0001237
OrthoInspector 1 1.000 - - otm41814
orthoMCL 1 0.900 - - OOG6_100814
Panther 1 1.100 - - LDO PTHR12538
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1241
SonicParanoid 1 1.000 - - X694
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
1313.010

Return to query results.
Submit another query.