DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and rps26

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001005121.1 Gene:rps26 / 448703 XenbaseID:XB-GENE-965887 Length:115 Species:Xenopus tropicalis


Alignment Length:103 Identity:87/103 - (84%)
Similarity:93/103 - (90%) Gaps:0/103 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLP 65
            |||||||.||.|..||||:|:||||||||||||||||||||||||||||||||:|||::|||.||
 Frog     1 MTKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDSYALP 65

  Fly    66 KLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLRSFP 103
            |||.|||||||||||||||||||||||:.||||.|..|
 Frog    66 KLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRP 103

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 87/103 (84%)
rps26NP_001005121.1 Ribosomal_S26e 1..101 CDD:307447 85/99 (86%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 1 1.000 180 1.000 Domainoid score I3465
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H37420
Inparanoid 1 1.050 180 1.000 Inparanoid score I3895
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591366at2759
OrthoFinder 1 1.000 - - FOG0001237
OrthoInspector 1 1.000 - - oto104678
Panther 1 1.100 - - LDO PTHR12538
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1241
SonicParanoid 1 1.000 - - X694
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
99.190

Return to query results.
Submit another query.