DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and rps26l

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_957036.1 Gene:rps26l / 393715 ZFINID:ZDB-GENE-040426-1706 Length:115 Species:Danio rerio


Alignment Length:107 Identity:89/107 - (83%)
Similarity:95/107 - (88%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLP 65
            |||||||.||.|..||||:|:||||||||||||||||||||||||||||||||:|||::||||||
Zfish     1 MTKKRRNNGRAKKGRGHVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDSYVLP 65

  Fly    66 KLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLRSFPKDMA 107
            |||.|||||||||||||||||||||||:.||||.|..|...|
Zfish    66 KLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPSGAA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 88/103 (85%)
rps26lNP_957036.1 Ribosomal_S26e 1..101 CDD:279607 86/99 (87%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C170578632
Domainoid 1 1.000 183 1.000 Domainoid score I3373
eggNOG 1 0.900 - - E1_COG4830
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37420
Inparanoid 1 1.050 184 1.000 Inparanoid score I3940
OMA 1 1.010 - - QHG62164
OrthoDB 1 1.010 - - D1591366at2759
OrthoFinder 1 1.000 - - FOG0001237
OrthoInspector 1 1.000 - - otm25875
orthoMCL 1 0.900 - - OOG6_100814
Panther 1 1.100 - - LDO PTHR12538
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1241
SonicParanoid 1 1.000 - - X694
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
ZFIN 00.000 Not matched by this tool.
1615.800

Return to query results.
Submit another query.