DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and RGD1559808

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_236845.2 Gene:RGD1559808 / 316158 RGDID:1559808 Length:130 Species:Rattus norvegicus


Alignment Length:107 Identity:77/107 - (71%)
Similarity:86/107 - (80%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLP 65
            |||||||.||.|..||||:|:.|.||:.|||||||||||||.||||.||||||:||.|:|:||||
  Rat    16 MTKKRRNNGRTKKGRGHVQPIGCANCSWCVPKDKAIKKFVIWNIVETAAVRDISEARIFDAYVLP 80

  Fly    66 KLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLRSFPKDMA 107
            |||.|||||||.||||||:||:|.|||:.||.|.|..|...|
  Rat    81 KLYVKLHYCVSLAIHSKVIRNQSHEARKDRTSPPRFRPAGAA 122

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 76/103 (74%)
RGD1559808XP_236845.2 Ribosomal_S26e 16..116 CDD:396032 74/99 (75%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339052
Domainoid 1 1.000 182 1.000 Domainoid score I3365
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3862
OMA 1 1.010 - - QHG62164
OrthoDB 1 1.010 - - D1591366at2759
OrthoFinder 1 1.000 - - FOG0001237
OrthoInspector 1 1.000 - - otm45953
orthoMCL 1 0.900 - - OOG6_100814
Panther 1 1.100 - - O PTHR12538
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X694
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1312.910

Return to query results.
Submit another query.