DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and Rps26-ps13

DIOPT Version :10

Sequence 1:NP_523595.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_221359.1 Gene:Rps26-ps13 / 303862 RGDID:1562415 Length:138 Species:Rattus norvegicus


Alignment Length:105 Identity:77/105 - (73%)
Similarity:85/105 - (80%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKL 67
            :|.||.|..|....||:|:|||||.||||||||||||||||||||||||||:|||::|:||||||
  Rat    26 QKWRNKGCAKKGPSHVQPIRCTNCTRCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKL 90

  Fly    68 YAKLHYCVSCAIHSKVVRNRSREARRIRTPPLRSFPKDMA 107
            |.|||||||||||||||||.|.|||:..|||.|..|...|
  Rat    91 YVKLHYCVSCAIHSKVVRNPSCEARKDGTPPPRFRPAGAA 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_523595.1 Ribosomal_S26e 1..104 CDD:426179 75/100 (75%)
Rps26-ps13XP_221359.1 Ribosomal_S26e 26..124 CDD:426179 74/97 (76%)

Return to query results.
Submit another query.