DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and RGD1562415

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_221359.1 Gene:RGD1562415 / 303862 RGDID:1562415 Length:138 Species:Rattus norvegicus


Alignment Length:105 Identity:77/105 - (73%)
Similarity:85/105 - (80%) Gaps:0/105 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 KKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKL 67
            :|.||.|..|....||:|:|||||.||||||||||||||||||||||||||:|||::|:||||||
  Rat    26 QKWRNKGCAKKGPSHVQPIRCTNCTRCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLPKL 90

  Fly    68 YAKLHYCVSCAIHSKVVRNRSREARRIRTPPLRSFPKDMA 107
            |.|||||||||||||||||.|.|||:..|||.|..|...|
  Rat    91 YVKLHYCVSCAIHSKVVRNPSCEARKDGTPPPRFRPAGAA 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 76/101 (75%)
RGD1562415XP_221359.1 Ribosomal_S26e 26..124 CDD:279607 74/97 (76%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339048
Domainoid 1 1.000 182 1.000 Domainoid score I3365
eggNOG 00.000 Not matched by this tool.
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3862
OMA 1 1.010 - - QHG62164
OrthoDB 1 1.010 - - D1591366at2759
OrthoFinder 1 1.000 - - FOG0001237
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 1 0.900 - - OOG6_100814
Panther 1 1.100 - - O PTHR12538
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X694
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1211.910

Return to query results.
Submit another query.