DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and RGD1565117

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_006241565.1 Gene:RGD1565117 / 299848 RGDID:1565117 Length:126 Species:Rattus norvegicus


Alignment Length:107 Identity:71/107 - (66%)
Similarity:82/107 - (76%) Gaps:9/107 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLP 65
            |||||:|..|.|...|||:|:||||||:|||      ||:||||:||||||||:|||::|:||||
  Rat    21 MTKKRKNNSRAKKGLGHVQPIRCTNCAQCVP------KFIIRNIIEAAAVRDISEASVFDAYVLP 79

  Fly    66 KLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLRSFPKDMA 107
            ||:.||||||||||||||.||.|||.   ||||.|..|...|
  Rat    80 KLFVKLHYCVSCAIHSKVTRNPSRED---RTPPPRFRPAGTA 118

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 70/103 (68%)
RGD1565117XP_006241565.1 Ribosomal_S26e 21..112 CDD:279607 68/99 (69%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339053
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG4830
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3862
OMA 1 1.010 - - QHG62164
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0001237
OrthoInspector 1 1.000 - - otm45953
orthoMCL 1 0.900 - - OOG6_100814
Panther 1 1.100 - - O PTHR12538
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X694
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1312.760

Return to query results.
Submit another query.