DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and rps-26

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:NP_001370049.1 Gene:rps-26 / 173342 WormBaseID:WBGene00004495 Length:117 Species:Caenorhabditis elegans


Alignment Length:100 Identity:78/100 - (78%)
Similarity:84/100 - (84%) Gaps:0/100 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLP 65
            ||.||||.||||.|||||..:|||||.||.||||||||||:||||||||||||.:||.:..|.||
 Worm     1 MTFKRRNHGRNKKNRGHVAFIRCTNCGRCCPKDKAIKKFVVRNIVEAAAVRDIGDASAYTQYALP 65

  Fly    66 KLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLR 100
            |||.|||||::|||||||||||||||||.|.||.|
 Worm    66 KLYHKLHYCIACAIHSKVVRNRSREARRDRNPPPR 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 77/99 (78%)
rps-26NP_001370049.1 Ribosomal_S26e 1..103 CDD:396032 77/99 (78%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160158539
Domainoid 1 1.000 163 1.000 Domainoid score I2413
eggNOG 1 0.900 - - E1_COG4830
Hieranoid 1 1.000 - -
Homologene 1 1.000 - - H37420
Inparanoid 1 1.050 163 1.000 Inparanoid score I2829
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG62164
OrthoDB 1 1.010 - - D1591366at2759
OrthoFinder 1 1.000 - - FOG0001237
OrthoInspector 1 1.000 - - oto18565
orthoMCL 1 0.900 - - OOG6_100814
Panther 1 1.100 - - LDO PTHR12538
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1241
SonicParanoid 1 1.000 - - X694
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
1615.840

Return to query results.
Submit another query.