DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and LOC108349054

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_038955222.1 Gene:LOC108349054 / 108349054 RGDID:11520367 Length:82 Species:Rattus norvegicus


Alignment Length:80 Identity:63/80 - (78%)
Similarity:73/80 - (91%) Gaps:0/80 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 VKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLPKLYAKLHYCVSCAIHSK 82
            ::|:..|||||||||||.||||||||.|||||||||:||.::::|||||||.|||||||||||||
  Rat     1 MQPIHGTNCARCVPKDKVIKKFVIRNTVEAAAVRDISEARVFNAYVLPKLYVKLHYCVSCAIHSK 65

  Fly    83 VVRNRSREARRIRTP 97
            |:||||||||:.|||
  Rat    66 VIRNRSREARKDRTP 80

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 63/80 (79%)
LOC108349054XP_038955222.1 Ribosomal_S26e 2..82 CDD:396032 63/79 (80%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1591366at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.010

Return to query results.
Submit another query.