DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment RpS26 and LOC100361854

DIOPT Version :9

Sequence 1:NP_001260537.1 Gene:RpS26 / 35098 FlyBaseID:FBgn0261597 Length:114 Species:Drosophila melanogaster
Sequence 2:XP_002730256.1 Gene:LOC100361854 / 100361854 RGDID:2319323 Length:115 Species:Rattus norvegicus


Alignment Length:107 Identity:87/107 - (81%)
Similarity:94/107 - (87%) Gaps:0/107 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MTKKRRNGGRNKHNRGHVKPVRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDITEASIWDSYVLP 65
            |||||||.||.|..||.|:|:||||||||||||||||||||||||||||||||:|||::|:||||
  Rat     1 MTKKRRNNGRAKKGRGQVQPIRCTNCARCVPKDKAIKKFVIRNIVEAAAVRDISEASVFDAYVLP 65

  Fly    66 KLYAKLHYCVSCAIHSKVVRNRSREARRIRTPPLRSFPKDMA 107
            |||.|||||||||||||||||||||||:.||||.|..|...|
  Rat    66 KLYVKLHYCVSCAIHSKVVRNRSREARKDRTPPPRFRPAGAA 107

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
RpS26NP_001260537.1 Ribosomal_S26e 1..105 CDD:396032 86/103 (83%)
LOC100361854XP_002730256.1 Ribosomal_S26e 1..101 CDD:396032 84/99 (85%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C166339054
Domainoid 1 1.000 182 1.000 Domainoid score I3365
eggNOG 1 0.900 - - E1_COG4830
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 183 1.000 Inparanoid score I3862
OMA 1 1.010 - - QHG62164
OrthoDB 1 1.010 - - D1591366at2759
OrthoFinder 1 1.000 - - FOG0001237
OrthoInspector 1 1.000 - - otm45953
orthoMCL 1 0.900 - - OOG6_100814
Panther 1 1.100 - - O PTHR12538
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X694
SwiftOrtho 1 1.000 - -
TreeFam 1 0.960 - -
1514.770

Return to query results.
Submit another query.