DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas3 and CADM3

DIOPT Version :10

Sequence 1:NP_001097174.1 Gene:Fas3 / 35097 FlyBaseID:FBgn0000636 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_024304528.1 Gene:CADM3 / 57863 HGNCID:17601 Length:481 Species:Homo sapiens


Alignment Length:397 Identity:83/397 - (20%)
Similarity:142/397 - (35%) Gaps:106/397 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 ICLAAILTDALTWAQVNVEPNTALLNEGDRTELLCRYGRSINYCRIEIPGEQKVLNLSPEWSKTP 71
            ||| .:..|:..|..               .|.:...|..:..|:::...:.     |.:||...
Human   106 ICL-CVFRDSQPWTS---------------DETVVAGGTVVLKCQVKDHEDS-----SLQWSNPA 149

  Fly    72 GFT-YFG------------AGLTAGQCGVSIERVKASNNGQVKCSLGVEGEELSGTIDLVVALRP 123
            ..| |||            ...|..:..:||..|..::.|:..||:.......:.::..|:.: |
Human   150 QQTLYFGEKRALRDNRIQLVTSTPHELSISISNVALADEGEYTCSIFTMPVRTAKSLVTVLGI-P 213

  Fly   124 QQPIIELLSRPNREGY---FNEGTEFRARCSVRDGRPPANISWYIDNMPANKRTTPLEVMSSTND 185
            |:|||        .||   ..|.......|.....:|.|.::|...:...:...|.::    .:.
Human   214 QKPII--------TGYKSSLREKDTATLNCQSSGSKPAARLTWRKGDQELHGEPTRIQ----EDP 266

  Fly   186 NVELSTSVQEIQWHLSPEDSNRKLVCRSHHQT----DRESVPPQEAAYIINVRYAP--VHQPDAA 244
            |.:..|....:.:.::.||....:||..:|::    ||.:      :..|.|.|.|  :.:||  
Human   267 NGKTFTVSSSVTFQVTREDDGASIVCSVNHESLKGADRST------SQRIEVLYTPTAMIRPD-- 323

  Fly   245 VYGLYLEHTAIVNITIRASPQPKIEWTIDGAIVGQG---RTDGRYSAYEPQYLGNDEYNV----- 301
                              .|.|:         .||.   ..:||.:....|||...|.:|     
Human   324 ------------------PPHPR---------EGQKLLLHCEGRGNPVPQQYLWEKEGSVPPLKM 361

  Fly   302 ----TLAIAGLTLEDTTKIYNLRASNELG--LTDYQVRISSSSKPPSSSLDVAAIVGIVVAVAVL 360
                .|....|...| :..|...|::.:|  ...|.:.::..|..||||....||:|.:||..|.
Human   362 TQESALIFPFLNKSD-SGTYGCTATSNMGSYKAYYTLNVNDPSPVPSSSSTYHAIIGGIVAFIVF 425

  Fly   361 VLVVLLI 367
            :|:::||
Human   426 LLLIMLI 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas3NP_001097174.1 C2-set_2 141..222 CDD:400489 15/84 (18%)
Ig strand B 146..150 CDD:409353 0/3 (0%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 194..198 CDD:409353 0/3 (0%)
Ig strand F 208..213 CDD:409353 2/4 (50%)
Ig strand G 226..229 CDD:409353 0/2 (0%)
Ig 253..326 CDD:472250 16/84 (19%)
CADM3XP_024304528.1 IgV_1_Necl-1 115..209 CDD:143290 18/113 (16%)
Ig strand A 115..118 CDD:143290 0/2 (0%)
FR1 116..134 CDD:143290 3/32 (9%)
Ig strand A' 119..125 CDD:143290 1/20 (5%)
Ig strand B 127..135 CDD:143290 2/7 (29%)
CDR1 135..140 CDD:143290 0/4 (0%)
FR2 141..148 CDD:143290 3/11 (27%)
Ig strand C 141..147 CDD:143290 2/10 (20%)
CDR2 149..160 CDD:143290 4/10 (40%)
Ig strand C' 151..155 CDD:143290 1/3 (33%)
Ig strand C' 157..160 CDD:143290 0/2 (0%)
FR3 161..196 CDD:143290 7/34 (21%)
Ig strand D 165..172 CDD:143290 0/6 (0%)
Ig strand E 175..181 CDD:143290 1/5 (20%)
Ig strand F 188..196 CDD:143290 3/7 (43%)
CDR3 197..200 CDD:143290 0/2 (0%)
Ig strand G 200..209 CDD:143290 0/8 (0%)
FR4 202..209 CDD:143290 0/6 (0%)
IgI_2_Necl-1 210..312 CDD:409502 23/120 (19%)
Ig strand A 210..213 CDD:409502 0/3 (0%)
Ig strand A' 216..220 CDD:409502 3/11 (27%)
Ig strand B 229..239 CDD:409502 1/9 (11%)
Ig strand C 242..251 CDD:409502 3/8 (38%)
Ig strand C' 252..255 CDD:409502 0/2 (0%)
Ig strand D 258..265 CDD:409502 1/10 (10%)
Ig strand E 270..280 CDD:409502 1/9 (11%)
Ig strand F 288..296 CDD:409502 2/7 (29%)
Ig strand G 304..311 CDD:409502 1/12 (8%)
IG_like 328..399 CDD:214653 16/80 (20%)
Ig strand B 333..337 CDD:409504 0/3 (0%)
Ig strand C 347..351 CDD:409504 3/3 (100%)
Ig strand E 365..369 CDD:409504 1/3 (33%)
Ig strand F 379..384 CDD:409504 1/4 (25%)
4.1m 437..452 CDD:128590
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.