DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas3 and F11R

DIOPT Version :10

Sequence 1:NP_001097174.1 Gene:Fas3 / 35097 FlyBaseID:FBgn0000636 Length:577 Species:Drosophila melanogaster
Sequence 2:NP_001369656.1 Gene:F11R / 50848 HGNCID:14685 Length:327 Species:Homo sapiens


Alignment Length:226 Identity:53/226 - (23%)
Similarity:89/226 - (39%) Gaps:51/226 - (22%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 RIVFICLAAILTDALTWAQVNV---EPNTALLNEGDRTELLCRY-GRSINYCRIEIPGEQKVLNL 63
            :::.:.:.|||..:|....|.|   ||... :.|.:..:|.|.| |.|                 
Human    10 KLLCLFILAILLCSLALGSVTVHSSEPEVR-IPENNPVKLSCAYSGFS----------------- 56

  Fly    64 SP--EWSKTPGFT----YFGAGLTAG--------QCGVSIERVKASNNGQVKCSLGVEGEELSG- 113
            ||  ||....|.|    .:...:||.        ..|::.:.|...:.|...|.:..||....| 
Human    57 SPRVEWKFDQGDTTRLVCYNNKITASYEDRVTFLPTGITFKSVTREDTGTYTCMVSEEGGNSYGE 121

  Fly   114 -TIDLVVALRPQQPIIELLSRPNREGYFNEGTEFRARCSVRDGRPPANISWYIDN--MPANKRTT 175
             .:.|:|.:.|.:|.:.:.|..      ..|......||.:||.||:..:|:.|.  ||.|.::|
Human   122 VKVKLIVLVPPSKPTVNIPSSA------TIGNRAVLTCSEQDGSPPSEYTWFKDGIVMPTNPKST 180

  Fly   176 PLEVMSSTNDNVELSTSVQEIQWH-LSPEDS 205
                .:.:|.:..|:.:..|:.:. ||..|:
Human   181 ----RAFSNSSYVLNPTTGELVFDPLSASDT 207

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas3NP_001097174.1 C2-set_2 141..222 CDD:400489 19/68 (28%)
Ig strand B 146..150 CDD:409353 0/3 (0%)
Ig strand C 160..164 CDD:409353 0/3 (0%)
Ig strand E 194..198 CDD:409353 1/3 (33%)
Ig strand F 208..213 CDD:409353
Ig strand G 226..229 CDD:409353
Ig 253..326 CDD:472250
F11RNP_001369656.1 IgV_1_JAM1-like 30..129 CDD:409538 25/116 (22%)
FR1 30..52 CDD:409538 6/22 (27%)
Ig strand A 30..33 CDD:409538 1/2 (50%)
Ig strand A' 37..41 CDD:409538 0/4 (0%)
Ig strand B 44..53 CDD:409538 2/8 (25%)
CDR1 53..58 CDD:409538 2/21 (10%)
Ig strand C 58..66 CDD:409538 3/7 (43%)
FR2 59..66 CDD:409538 2/6 (33%)
CDR2 69..83 CDD:409538 3/13 (23%)
Ig strand C' 69..74 CDD:409538 1/4 (25%)
Ig strand C' 77..79 CDD:409538 0/1 (0%)
FR3 84..112 CDD:409538 4/27 (15%)
Ig strand D 86..90 CDD:409538 0/3 (0%)
Ig strand E 92..96 CDD:409538 1/3 (33%)
Ig strand F 105..113 CDD:409538 2/7 (29%)
CDR3 113..119 CDD:409538 2/5 (40%)
Ig strand G 119..128 CDD:409538 2/8 (25%)
FR4 120..129 CDD:409538 2/8 (25%)
IgI_2_JAM1 135..231 CDD:409542 21/83 (25%)
Ig strand A 135..139 CDD:409542 1/3 (33%)
Ig strand A' 141..144 CDD:409542 1/8 (13%)
Ig strand B 147..155 CDD:409542 1/7 (14%)
Ig strand C 163..168 CDD:409542 1/4 (25%)
Ig strand C' 170..172 CDD:409542 0/1 (0%)
Ig strand D 187..191 CDD:409542 0/3 (0%)
Ig strand E 195..199 CDD:409542 1/3 (33%)
Ig strand F 208..214 CDD:409542 53/226 (23%)
Ig strand G 221..231 CDD:409542
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.