DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Fas3 and CADM2

DIOPT Version :10

Sequence 1:NP_001097174.1 Gene:Fas3 / 35097 FlyBaseID:FBgn0000636 Length:577 Species:Drosophila melanogaster
Sequence 2:XP_016861551.1 Gene:CADM2 / 253559 HGNCID:29849 Length:449 Species:Homo sapiens


Alignment Length:442 Identity:100/442 - (22%)
Similarity:155/442 - (35%) Gaps:135/442 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 GRSINYCRIEIPGEQKVLNLSPEWSKTPGFT-YFG------------AGLTAGQCGVSIERVKAS 95
            |.:|..||::     :..|.|.:||.....| ||.            ...:..:..:|:..|..|
Human    52 GTAILTCRVD-----QNDNTSLQWSNPAQQTLYFDDKKALRDNRIELVRASWHELSISVSDVSLS 111

  Fly    96 NNGQVKCSLGVEGEELSGTIDLVVALRPQQPIIELLSRPNREGYFNEGTEFRARCSVRDGRPPAN 160
            :.||..|||.....:.|.....|:.: |::|.|...|.|..||...:.|     |.....:|.|:
Human   112 DEGQYTCSLFTMPVKTSKAYLTVLGV-PEKPQISGFSSPVMEGDLMQLT-----CKTSGSKPAAD 170

  Fly   161 ISW-----------YIDNMPANKRTTPLEVMSSTNDNVELSTSVQEIQWHLSPEDSNRKLVCRSH 214
            |.|           |:....||::|.   .:|||.|            :.:...|....::||..
Human   171 IRWFKNDKEIKDVKYLKEEDANRKTF---TVSSTLD------------FRVDRSDDGVAVICRVD 220

  Fly   215 HQTDRESVPPQEAAYIINVRYAP------------VHQPDAAVYGLYLEHTAIVNITIRASPQPK 267
            |::  .:..||.|..::.:.|.|            ..||            .|:....:..|.|:
Human   221 HES--LNATPQVAMQVLEIHYTPSVKIIPSTPFPQEGQP------------LILTCESKGKPLPE 271

  Fly   268 -IEWTIDGA-------IVGQGR---------TD-GRYSAYEPQYLGNDEYNVTLAIAGL--TLED 312
             :.||.||.       :|..||         || |.|.......:|.......|.:..:  ||..
Human   272 PVLWTKDGGELPDPDRMVVSGRELNILFLNKTDNGTYRCEATNTIGQSSAEYVLIVHDVPNTLLP 336

  Fly   313 TTKIYNLRASNELGLTDYQVRISSSSKPPSSSL------------DVAAIVGIVVAVAVLVLVVL 365
            ||.|.:|..:..  .|...:..|.::...:||:            |.|.|.||   |||:|.|.|
Human   337 TTIIPSLTTATV--TTTVAITTSPTTSATTSSIRDPNALAGQNGPDHALIGGI---VAVVVFVTL 396

  Fly   366 LIVF------ARATGRWCFGGKSIKTPTNETQIDKQLELGAQQNHGQNVALL 411
            ..:|      ||..|.:.         |||.:       ||:.....:.|::
Human   397 CSIFLLGRYLARHKGTYL---------TNEAK-------GAEDAPDADTAII 432

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Fas3NP_001097174.1 C2-set_2 141..222 CDD:400489 18/91 (20%)
Ig strand B 146..150 CDD:409353 0/3 (0%)
Ig strand C 160..164 CDD:409353 2/14 (14%)
Ig strand E 194..198 CDD:409353 0/3 (0%)
Ig strand F 208..213 CDD:409353 1/4 (25%)
Ig strand G 226..229 CDD:409353 1/2 (50%)
Ig 253..326 CDD:472250 22/92 (24%)
CADM2XP_016861551.1 IgV_1_Necl-3 40..135 CDD:409498 20/87 (23%)
Ig strand A 40..43 CDD:409498
FR1 41..59 CDD:409498 2/6 (33%)
Ig strand A' 44..50 CDD:409498
Ig strand B 52..60 CDD:409498 3/7 (43%)
CDR1 60..65 CDD:409498 0/9 (0%)
FR2 66..73 CDD:409498 3/6 (50%)
Ig strand C 66..72 CDD:409498 2/5 (40%)
CDR2 74..85 CDD:409498 3/10 (30%)
Ig strand C' 76..80 CDD:409498 1/3 (33%)
Ig strand C' 82..85 CDD:409498 0/2 (0%)
FR3 86..121 CDD:409498 7/34 (21%)
Ig strand D 90..97 CDD:409498 0/6 (0%)
Ig strand E 100..106 CDD:409498 1/5 (20%)
Ig strand F 113..121 CDD:409498 4/7 (57%)
CDR3 122..125 CDD:409498 0/2 (0%)
Ig strand G 125..135 CDD:409498 1/9 (11%)
FR4 127..134 CDD:409498 1/6 (17%)
IgI_2_Necl-3 134..237 CDD:409467 29/125 (23%)
Ig strand A 135..138 CDD:409467 0/3 (0%)
Ig strand A' 141..145 CDD:409467 2/3 (67%)
Ig strand B 154..164 CDD:409467 2/14 (14%)
Ig strand C 167..176 CDD:409467 4/8 (50%)
Ig strand C' 177..180 CDD:409467 0/2 (0%)
Ig strand D 182..189 CDD:409467 1/6 (17%)
Ig strand E 195..205 CDD:409467 5/24 (21%)
Ig strand F 213..221 CDD:409467 2/7 (29%)
Ig strand G 229..236 CDD:409467 2/6 (33%)
Ig_3 241..314 CDD:464046 17/84 (20%)
4.1m 402..420 CDD:128590 6/33 (18%)
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.